SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U37547-1|AAC50508.1|  618|Homo sapiens MIHB protein.                   69   3e-11
L49431-1|AAC41942.1|  618|Homo sapiens TNFR2-TRAF signalling com...    69   3e-11
DQ068066-1|AAY46158.1|  618|Homo sapiens baculoviral IAP repeat-...    69   3e-11
BC028578-1|AAH28578.1|  618|Homo sapiens BIRC2 protein protein.        69   3e-11
BC016174-1|AAH16174.1|  618|Homo sapiens baculoviral IAP repeat-...    69   3e-11
AF207599-1|AAN73272.1|  534|Homo sapiens pRb-interacting protein...    69   3e-11
U45879-1|AAC50372.1|  618|Homo sapiens inhibitor of apoptosis pr...    68   3e-11
U45878-1|AAC50371.1|  604|Homo sapiens inhibitor of apoptosis pr...    64   4e-10
U37546-1|AAC50507.1|  604|Homo sapiens MIHC protein.                   64   4e-10
L49432-1|AAC41943.1|  604|Homo sapiens TNFR2-TRAF signalling com...    64   4e-10
BC037420-1|AAH37420.1|  604|Homo sapiens baculoviral IAP repeat-...    64   4e-10
AY764389-1|AAU88144.1|  604|Homo sapiens baculoviral IAP repeat-...    64   4e-10
AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein...    64   4e-10
AF070674-1|AAC83232.1|  604|Homo sapiens inhibitor of apoptosis ...    64   4e-10
BC014475-1|AAH14475.1|  298|Homo sapiens baculoviral IAP repeat-...    60   7e-09
AY517497-1|AAS01729.1|  224|Homo sapiens baculoviral IAP repeat-...    60   7e-09
AY358836-1|AAQ89195.1|  298|Homo sapiens LIVIN protein.                60   7e-09
AY358835-1|AAQ89194.1|  280|Homo sapiens LIVIN protein.                60   7e-09
AJ309298-2|CAC37338.1|  298|Homo sapiens inhibitor of apoptosis ...    60   7e-09
AJ309298-1|CAC37337.1|  280|Homo sapiens inhibitor of apoptosis ...    60   7e-09
AF311388-1|AAG33622.1|  280|Homo sapiens livin inhibitor-of-apot...    60   7e-09
AF301009-1|AAG37878.1|  298|Homo sapiens inhibitor of apoptosis ...    60   7e-09
U45880-1|AAC50373.1|  497|Homo sapiens X-linked inhibitor of apo...    60   9e-09
U32974-1|AAC50518.1|  497|Homo sapiens IAP-like protein ILP prot...    60   9e-09
BC032729-1|AAH32729.1|  497|Homo sapiens baculoviral IAP repeat-...    60   9e-09
AY886519-1|AAW62257.1|  497|Homo sapiens baculoviral IAP repeat-...    60   9e-09
AL121601-4|CAB95312.1|  497|Homo sapiens baculoviral IAP repeat-...    60   9e-09
U80017-2|AAC52047.1| 1403|Homo sapiens neuronal apoptosis inhibi...    54   5e-07
U19251-1|AAC52045.1| 1403|Homo sapiens neuronal apoptosis inhibi...    54   5e-07
BC071665-1|AAH71665.2|  236|Homo sapiens baculoviral IAP repeat-...    53   1e-06
BC039318-1|AAH39318.1|  236|Homo sapiens baculoviral IAP repeat-...    53   1e-06
AF420440-1|AAL30369.1|  236|Homo sapiens testis-specific inhibit...    53   1e-06
AF164682-1|AAK81892.1|  236|Homo sapiens IAP-like protein 2 prot...    53   1e-06
AF164681-1|AAK81891.1|  106|Homo sapiens IAP-like protein 3 prot...    52   2e-06
AC005031-1|AAC62261.1| 1178|Homo sapiens neuronal apoptosis inhi...    49   2e-05
AB048534-1|BAB87181.1| 1160|Homo sapiens psi neuronal apoptosis ...    49   2e-05
AL121601-3|CAI42584.1|  156|Homo sapiens baculoviral IAP repeat-...    48   5e-05
AF265555-1|AAF75772.1| 4829|Homo sapiens ubiquitin-conjugating B...    40   0.011
AY634315-1|AAT47482.2|  546|Homo sapiens Ras guanyl releasing pr...    31   3.7  
AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein.        31   4.9  
U75285-1|AAC51660.1|  142|Homo sapiens apoptosis inhibitor survi...    30   8.5  
CR541740-1|CAG46540.1|  142|Homo sapiens BIRC5 protein.                30   8.5  
BC109297-1|AAI09298.1|  797|Homo sapiens RAS guanyl releasing pr...    30   8.5  
BC109296-1|AAI09297.1|  797|Homo sapiens RAS guanyl releasing pr...    30   8.5  
BC067298-1|AAH67298.1|  765|Homo sapiens RASGRP1 protein protein.      30   8.5  
BC065497-1|AAH65497.1|  142|Homo sapiens baculoviral IAP repeat-...    30   8.5  
BC034148-1|AAH34148.1|  142|Homo sapiens baculoviral IAP repeat-...    30   8.5  
BC013568-1|AAH13568.1|  493|Homo sapiens phosphatidylinositol gl...    30   8.5  
BC008718-1|AAH08718.1|  142|Homo sapiens baculoviral IAP repeat-...    30   8.5  
AY954625-1|AAX54699.4|  762|Homo sapiens Ras guanyl releasing pr...    30   8.5  
AY858556-1|AAW32406.2|  597|Homo sapiens RAS guanyl releasing pr...    30   8.5  
AY795969-1|AAV40840.1|  142|Homo sapiens baculoviral IAP repeat-...    30   8.5  
AL034380-11|CAB92120.1|  493|Homo sapiens phosphatidylinositol g...    30   8.5  
AK000484-1|BAA91196.1|  493|Homo sapiens protein ( Homo sapiens ...    30   8.5  
AF106071-1|AAC97349.1|  797|Homo sapiens ras activator RasGRP pr...    30   8.5  
AF081197-1|AAF21898.1|  782|Homo sapiens calcium and DAG-regulat...    30   8.5  
AF081195-1|AAC79699.1|  797|Homo sapiens calcium and DAG-regulat...    30   8.5  
AF077350-1|AAD34226.1|  142|Homo sapiens inhibitor of apoptosis ...    30   8.5  
AB208848-1|BAD92085.1|  530|Homo sapiens Ras activator RasGRP va...    30   8.5  
AB154416-1|BAD11155.1|  120|Homo sapiens survivin-3B protein pro...    30   8.5  

>U37547-1|AAC50508.1|  618|Homo sapiens MIHB protein.
          Length = 618

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>L49431-1|AAC41942.1|  618|Homo sapiens TNFR2-TRAF signalling
           complex protein protein.
          Length = 618

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>DQ068066-1|AAY46158.1|  618|Homo sapiens baculoviral IAP
           repeat-containing 2 protein.
          Length = 618

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>BC028578-1|AAH28578.1|  618|Homo sapiens BIRC2 protein protein.
          Length = 618

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>BC016174-1|AAH16174.1|  618|Homo sapiens baculoviral IAP
           repeat-containing 2 protein.
          Length = 618

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>AF207599-1|AAN73272.1|  534|Homo sapiens pRb-interacting protein
           RbBP-36 protein.
          Length = 534

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 19/60 (31%), Positives = 26/60 (43%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG  Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFDYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>U45879-1|AAC50372.1|  618|Homo sapiens inhibitor of apoptosis
           protein 2 protein.
          Length = 618

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFGCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>U45878-1|AAC50371.1|  604|Homo sapiens inhibitor of apoptosis
           protein 1 protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLARAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>U37546-1|AAC50507.1|  604|Homo sapiens MIHC protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>L49432-1|AAC41943.1|  604|Homo sapiens TNFR2-TRAF signalling
           complex protein protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>BC037420-1|AAH37420.1|  604|Homo sapiens baculoviral IAP
           repeat-containing 3 protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AY764389-1|AAU88144.1|  604|Homo sapiens baculoviral IAP
           repeat-containing 3 protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein
           protein.
          Length = 1140

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AF070674-1|AAC83232.1|  604|Homo sapiens inhibitor of apoptosis
           protein-1 protein.
          Length = 604

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+++      +A AG +Y G  D+  CF CD  +R W   +D W +HA   P+C +++ 
Sbjct: 265 WPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIR 324

Query: 695 VKGKEF 712
           +KG+EF
Sbjct: 325 IKGQEF 330



 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP       T++A+AG +Y G GD   CF C   + +W   ++A   H    P+C F+
Sbjct: 179 WPLTFLSP-TDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFI 235



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +PA +     ++A AG +YTG  D+  CF C   + +W   +   ++H    P C FV S
Sbjct: 39  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQS 98

Query: 695 V 697
           +
Sbjct: 99  L 99



 Score = 31.1 bits (67), Expect = 4.9
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 48  RSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>BC014475-1|AAH14475.1|  298|Homo sapiens baculoviral IAP
           repeat-containing 7 (livin) protein.
          Length = 298

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AY517497-1|AAS01729.1|  224|Homo sapiens baculoviral IAP
           repeat-containing 7 protein.
          Length = 224

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AY358836-1|AAQ89195.1|  298|Homo sapiens LIVIN protein.
          Length = 298

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AY358835-1|AAQ89194.1|  280|Homo sapiens LIVIN protein.
          Length = 280

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AJ309298-2|CAC37338.1|  298|Homo sapiens inhibitor of apoptosis
           protein.
          Length = 298

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AJ309298-1|CAC37337.1|  280|Homo sapiens inhibitor of apoptosis
           protein.
          Length = 280

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AF311388-1|AAG33622.1|  280|Homo sapiens livin
           inhibitor-of-apotosis protein.
          Length = 280

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>AF301009-1|AAG37878.1|  298|Homo sapiens inhibitor of apoptosis
           protein KIAP protein.
          Length = 298

 Score = 60.5 bits (140), Expect = 7e-09
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>U45880-1|AAC50373.1|  497|Homo sapiens X-linked inhibitor of
           apotosis protein protein.
          Length = 497

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>U32974-1|AAC50518.1|  497|Homo sapiens IAP-like protein ILP
           protein.
          Length = 497

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>BC032729-1|AAH32729.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>AY886519-1|AAW62257.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>AL121601-4|CAB95312.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>U80017-2|AAC52047.1| 1403|Homo sapiens neuronal apoptosis
           inhibitory protein protein.
          Length = 1403

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++EAG  +TG+ D   CF C  C+ +W   +D W+ HA   P+C F+ S K  E
Sbjct: 181 LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSE 234



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +A+AGLFYTG  D   CF C  C+  W   +D    H    P C F+ +
Sbjct: 288 WPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQN 347

Query: 695 VK 700
           +K
Sbjct: 348 MK 349


>U19251-1|AAC52045.1| 1403|Homo sapiens neuronal apoptosis
           inhibitory protein protein.
          Length = 1403

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++EAG  +TG+ D   CF C  C+ +W   +D W+ HA   P+C F+ S K  E
Sbjct: 181 LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSE 234



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +A+AGLFYTG  D   CF C  C+  W   +D    H    P C F+ +
Sbjct: 288 WPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQN 347

Query: 695 VK 700
           +K
Sbjct: 348 MK 349


>BC071665-1|AAH71665.2|  236|Homo sapiens baculoviral IAP
           repeat-containing 8 protein.
          Length = 236

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           +A AG +  G+ D+  CF C   + +W   ED W++HA   P C ++L  KG E+  N
Sbjct: 23  LARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINN 80


>BC039318-1|AAH39318.1|  236|Homo sapiens baculoviral IAP
           repeat-containing 8 protein.
          Length = 236

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           +A AG +  G+ D+  CF C   + +W   ED W++HA   P C ++L  KG E+  N
Sbjct: 23  LARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINN 80


>AF420440-1|AAL30369.1|  236|Homo sapiens testis-specific inhibitor
           of apoptosis protein.
          Length = 236

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           +A AG +  G+ D+  CF C   + +W   ED W++HA   P C ++L  KG E+  N
Sbjct: 23  LARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINN 80


>AF164682-1|AAK81892.1|  236|Homo sapiens IAP-like protein 2
           protein.
          Length = 236

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           +A AG +  G+ D+  CF C   + +W   ED W++HA   P C ++L  KG E+  N
Sbjct: 23  LARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINN 80


>AF164681-1|AAK81891.1|  106|Homo sapiens IAP-like protein 3
           protein.
          Length = 106

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           ++ AG +  G GD+  CF C   + DW  +ED W++H   +P C ++L  K +++  N
Sbjct: 11  LSRAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHDKWHPGCKYLLEQKTRKYINN 68


>AC005031-1|AAC62261.1| 1178|Homo sapiens neuronal apoptosis
           inhibitory protein protein.
          Length = 1178

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +A+AGLFYTG  D   CF C  C+  W   +D    H    P C F+ +
Sbjct: 67  WPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQN 126

Query: 695 VK 700
           +K
Sbjct: 127 MK 128


>AB048534-1|BAB87181.1| 1160|Homo sapiens psi neuronal apoptosis
           inhibitory protein protein.
          Length = 1160

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +A+AGLFYTG  D   CF C  C+  W   +D    H    P C F+ +
Sbjct: 126 WPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQN 185

Query: 695 VK 700
           +K
Sbjct: 186 MK 187


>AL121601-3|CAI42584.1|  156|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 156

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>AF265555-1|AAF75772.1| 4829|Homo sapiens ubiquitin-conjugating
           BIR-domain enzyme APOLLON protein.
          Length = 4829

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C FV
Sbjct: 281 MAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFV 330


>AY634315-1|AAT47482.2|  546|Homo sapiens Ras guanyl releasing
           protein I splice variant D protein.
          Length = 546

 Score = 31.5 bits (68), Expect = 3.7
 Identities = 15/38 (39%), Positives = 19/38 (50%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR*YANHVRNNR 606
           F +T YL PT  +N AGF W V  +  R   N    +R
Sbjct: 509 FQETTYLKPTFCDNCAGFLWGVIKQGYRCKGNKYSESR 546


>AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein.
          Length = 4243

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -3

Query: 541  NHVTQCGRPKITNVSIRDCKLDMHLYTHLGLPSFTSTAL 425
            N++  C +  I N   + C+L+ HLY    LP+  ST L
Sbjct: 3870 NNLLVCPKTTIWNAQQKHCELNNHLYKDQFLPNLDSTVL 3908


>U75285-1|AAC51660.1|  142|Homo sapiens apoptosis inhibitor survivin
           protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>CR541740-1|CAG46540.1|  142|Homo sapiens BIRC5 protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>BC109297-1|AAI09298.1|  797|Homo sapiens RAS guanyl releasing
           protein 1 (calcium and DAG-regulated) protein.
          Length = 797

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 544 FQETTYLKPTFCDNCAGFLWGVIKQGYR 571


>BC109296-1|AAI09297.1|  797|Homo sapiens RAS guanyl releasing
           protein 1 (calcium and DAG-regulated) protein.
          Length = 797

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 544 FQETTYLKPTFCDNCAGFLWGVIKQGYR 571


>BC067298-1|AAH67298.1|  765|Homo sapiens RASGRP1 protein protein.
          Length = 765

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 544 FQETTYLKPTFCDNCAGFLWGVIKQGYR 571


>BC065497-1|AAH65497.1|  142|Homo sapiens baculoviral IAP
           repeat-containing 5 (survivin) protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>BC034148-1|AAH34148.1|  142|Homo sapiens baculoviral IAP
           repeat-containing 5 (survivin) protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>BC013568-1|AAH13568.1|  493|Homo sapiens phosphatidylinositol
           glycan anchor biosynthesis, class V protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -1

Query: 492 ATVNWTCICTHTWVCLLLLVQR 427
           A   WT + TH W+CL L +QR
Sbjct: 339 AWATWTYVTTHPWLCLTLGLQR 360


>BC008718-1|AAH08718.1|  142|Homo sapiens baculoviral IAP
           repeat-containing 5 (survivin) protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>AY954625-1|AAX54699.4|  762|Homo sapiens Ras guanyl releasing
           protein I splice variant A protein.
          Length = 762

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 509 FQETTYLKPTFCDNCAGFLWGVIKQGYR 536


>AY858556-1|AAW32406.2|  597|Homo sapiens RAS guanyl releasing
           protein I splice variant B protein.
          Length = 597

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 509 FQETTYLKPTFCDNCAGFLWGVIKQGYR 536


>AY795969-1|AAV40840.1|  142|Homo sapiens baculoviral IAP
           repeat-containing 5 (survivin) protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>AL034380-11|CAB92120.1|  493|Homo sapiens phosphatidylinositol
           glycan anchor biosynthesis, class V protein.
          Length = 493

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -1

Query: 492 ATVNWTCICTHTWVCLLLLVQR 427
           A   WT + TH W+CL L +QR
Sbjct: 339 AWATWTYVTTHPWLCLTLGLQR 360


>AK000484-1|BAA91196.1|  493|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20477 fis, clone KAT07271. ).
          Length = 493

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -1

Query: 492 ATVNWTCICTHTWVCLLLLVQR 427
           A   WT + TH W+CL L +QR
Sbjct: 339 AWATWTYVTTHPWLCLTLGLQR 360


>AF106071-1|AAC97349.1|  797|Homo sapiens ras activator RasGRP
           protein.
          Length = 797

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 544 FQETTYLKPTFCDNCAGFLWGVIKQGYR 571


>AF081197-1|AAF21898.1|  782|Homo sapiens calcium and DAG-regulated
           guanine nucleotide exchange factor II protein.
          Length = 782

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 529 FQETTYLKPTFCDNCAGFLWGVIKQGYR 556


>AF081195-1|AAC79699.1|  797|Homo sapiens calcium and DAG-regulated
           guanine nucleotide exchange factor II protein.
          Length = 797

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 544 FQETTYLKPTFCDNCAGFLWGVIKQGYR 571


>AF077350-1|AAD34226.1|  142|Homo sapiens inhibitor of apoptosis
           homolog protein.
          Length = 142

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


>AB208848-1|BAD92085.1|  530|Homo sapiens Ras activator RasGRP
           variant protein.
          Length = 530

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -2

Query: 719 FDKTLYLSPTIQNNIAGFRWRVAARRLR 636
           F +T YL PT  +N AGF W V  +  R
Sbjct: 277 FQETTYLKPTFCDNCAGFLWGVIKQGYR 304


>AB154416-1|BAD11155.1|  120|Homo sapiens survivin-3B protein
           protein.
          Length = 120

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +AEAG  +    +E     CFFC   +  W  ++D  + H   +  C F LSVK K+F
Sbjct: 38  MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF-LSVK-KQF 93


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,466,121
Number of Sequences: 237096
Number of extensions: 2219822
Number of successful extensions: 4990
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 4617
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4990
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9924838204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -