SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB209845-1|BAD93082.1|  165|Homo sapiens transcription terminati...    62   3e-09
AL445231-3|CAH71961.1| 1162|Homo sapiens transcription terminati...    61   5e-09
AL391476-7|CAI12738.1| 1162|Homo sapiens transcription terminati...    61   5e-09
AF080255-1|AAD49435.1| 1162|Homo sapiens lodestar protein protein.     61   5e-09
AF073771-1|AAC64044.1| 1162|Homo sapiens RNA polymerase II termi...    61   5e-09
Z46606-2|CAA86572.1|  887|Homo sapiens helicase-like transcripti...    54   8e-07
Z46606-1|CAA86571.1| 1009|Homo sapiens helicase-like transcripti...    54   8e-07
L34673-1|AAA67436.1| 1009|Homo sapiens ATPase protein.                 54   8e-07
BC044659-1|AAH44659.1| 1008|Homo sapiens helicase-like transcrip...    54   8e-07
AJ418064-1|CAD10805.1| 1009|Homo sapiens SWI/SNF related, matrix...    54   8e-07
AB209052-1|BAD92289.1|  992|Homo sapiens SWI/SNF-related matrix-...    54   8e-07
X97795-1|CAA66379.1|  747|Homo sapiens RAD54 protein.                  52   2e-06
BC121060-1|AAI21061.1|  747|Homo sapiens RAD54-like (S. cerevisi...    52   2e-06
BC121059-1|AAI21060.1|  747|Homo sapiens RAD54-like (S. cerevisi...    52   2e-06
AY623117-1|AAT38113.1|  747|Homo sapiens RAD54-like (S. cerevisi...    52   2e-06
AL121602-1|CAI22117.1|  747|Homo sapiens RAD54-like (S. cerevisi...    52   2e-06
U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator...    51   4e-06
D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator...    51   4e-06
BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix...    51   4e-06
AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.    51   4e-06
AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.    51   4e-06
AC006127-2|AAC97987.1|  661|Homo sapiens SN24_HUMAN protein.           51   4e-06
AC006127-1|AAC97986.1|  628|Homo sapiens BRG-1-HUMAN  [AA 812-14...    51   4e-06
AB209313-1|BAD92550.1| 1164|Homo sapiens SWI/SNF-related matrix-...    51   4e-06
X72889-1|CAA51407.1| 1586|Homo sapiens HBRM protein.                   50   1e-05
D26155-1|BAA05142.1| 1572|Homo sapiens transcriptional activator...    50   1e-05
BC001965-1|AAH01965.1|  910|Homo sapiens RAD54 homolog B (S. cer...    50   1e-05
AL359076-4|CAI12968.1| 1572|Homo sapiens SWI/SNF related, matrix...    50   1e-05
AL359076-3|CAI12967.1| 1590|Homo sapiens SWI/SNF related, matrix...    50   1e-05
AL138755-9|CAI14600.1| 1572|Homo sapiens SWI/SNF related, matrix...    50   1e-05
AL138755-8|CAI14599.1| 1590|Homo sapiens SWI/SNF related, matrix...    50   1e-05
AL133578-1|CAB63724.1|  580|Homo sapiens hypothetical protein pr...    50   1e-05
AF112481-1|AAD34331.1|  910|Homo sapiens RAD54B protein protein.       50   1e-05
EF560738-1|ABQ59048.1|  900|Homo sapiens CHD1L protein protein.        46   2e-04
BC043501-1|AAH43501.1|  890|Homo sapiens Similar to RIKEN cDNA 4...    46   2e-04
BC005038-1|AAH05038.1|  789|Homo sapiens CHD1L protein protein.        46   2e-04
BC001171-1|AAH01171.1|  896|Homo sapiens Unknown (protein for IM...    46   2e-04
AL356378-7|CAH72650.1|  897|Homo sapiens chromodomain helicase D...    46   2e-04
AK223496-1|BAD97216.1|  702|Homo sapiens chromodomain helicase D...    46   2e-04
AK027631-1|BAB55248.1|  521|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AK001342-1|BAA91637.1|  831|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AF537213-1|AAO49505.1|  897|Homo sapiens ALC1 protein.                 46   2e-04
BC045534-1|AAH45534.1| 1028|Homo sapiens SWI/SNF-related, matrix...    44   5e-04
AY008271-1|AAG16639.1| 1026|Homo sapiens helicase SMARCAD1 protein.    44   5e-04
AB032948-1|BAA86436.1| 1048|Homo sapiens KIAA1122 protein protein.     44   5e-04
BC023144-1|AAH23144.1| 1052|Homo sapiens SWI/SNF related, matrix...    44   8e-04
AC099396-1|AAY40920.1|  367|Homo sapiens unknown protein.              44   8e-04
AB010882-1|BAA25173.1| 1052|Homo sapiens hSNF2H protein.               44   8e-04
AY034072-1|AAK56405.1| 2713|Homo sapiens chromodomain helicase D...    43   0.001
AL121674-2|CAI21744.1| 2715|Homo sapiens chromodomain helicase D...    43   0.001
AL031669-3|CAI22255.1| 2715|Homo sapiens chromodomain helicase D...    43   0.001
AL031667-2|CAI42977.1| 2715|Homo sapiens chromodomain helicase D...    43   0.001
M89907-1|AAA80560.1|  769|Homo sapiens transcription activator p...    42   0.002
M88163-1|AAA80559.1|  976|Homo sapiens transcription activator p...    42   0.002
BC117686-1|AAI17687.1| 1683|Homo sapiens SHPRH protein protein.        42   0.002
BC117447-1|AAI17448.1| 1054|Homo sapiens SWI/SNF related, matrix...    42   0.002
BC052963-1|AAH52963.1| 1394|Homo sapiens SRCAP protein protein.        42   0.002
AY163808-1|AAO06907.1| 1659|Homo sapiens helicase-like protein p...    42   0.002
AY161136-1|AAO26201.1| 1683|Homo sapiens SNF2 histone linker PHD...    42   0.002
AL451145-1|CAH70765.1| 1683|Homo sapiens SNF2 histone linker PHD...    42   0.002
AL356599-2|CAI41120.1| 1683|Homo sapiens SNF2 histone linker PHD...    42   0.002
AL138745-3|CAI42614.1| 1005|Homo sapiens SWI/SNF related, matrix...    42   0.002
AL138745-2|CAI42612.1| 1042|Homo sapiens SWI/SNF related, matrix...    42   0.002
AL138745-1|CAI42613.1| 1054|Homo sapiens SWI/SNF related, matrix...    42   0.002
AL022577-3|CAI42684.1| 1005|Homo sapiens SWI/SNF related, matrix...    42   0.002
AL022577-2|CAI42682.1| 1042|Homo sapiens SWI/SNF related, matrix...    42   0.002
AL022577-1|CAI42683.1| 1054|Homo sapiens SWI/SNF related, matrix...    42   0.002
AK128030-1|BAC87237.1| 2427|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK023990-1|BAB14759.1|  361|Homo sapiens protein ( Homo sapiens ...    42   0.002
AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activat...    42   0.002
AB095943-1|BAC23119.1| 1092|Homo sapiens KIAA2023 protein protein.     42   0.002
AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.             42   0.002
BC035183-1|AAH35183.1|  523|Homo sapiens LOC375748 protein protein.    41   0.004
AL161454-5|CAI16517.1|  712|Homo sapiens chromosome 9 open readi...    41   0.004
AL161454-4|CAO03518.1|  365|Homo sapiens chromosome 9 open readi...    41   0.004
BC077717-1|AAH77717.1|  693|Homo sapiens CHD1L protein protein.        40   0.008
AL389952-1|CAB97530.1|  365|Homo sapiens RAD26L hypothetical pro...    40   0.008
AB046784-1|BAB13390.3| 2432|Homo sapiens KIAA1564 protein protein.     40   0.008
L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein p...    40   0.014
BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair cross-c...    40   0.014
BC117134-1|AAI17135.1| 1709|Homo sapiens chromodomain helicase D...    40   0.014
AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair cross-c...    40   0.014
AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair cross-c...    40   0.014
AF006513-1|AAB87381.1| 1709|Homo sapiens CHD1 protein.                 40   0.014
AB209504-1|BAD92741.1|  870|Homo sapiens excision repair cross-c...    40   0.014
AB037837-1|BAA92654.1| 1967|Homo sapiens KIAA1416 protein protein.     39   0.018
AL391476-1|CAI12731.1|  143|Homo sapiens transcription terminati...    38   0.041
AF006514-1|AAB87382.1| 1739|Homo sapiens CHD2 protein.                 38   0.055
AL035406-11|CAI19894.1| 1195|Homo sapiens chromodomain helicase ...    37   0.072
AL035406-9|CAI19891.1| 1954|Homo sapiens chromodomain helicase D...    37   0.072
AL031847-11|CAI19451.1| 1195|Homo sapiens chromodomain helicase ...    37   0.072
AL031847-10|CAI19450.1| 1954|Homo sapiens chromodomain helicase ...    37   0.072
AK131077-1|BAC85127.1| 1544|Homo sapiens FLJ00266 protein protein.     37   0.072
AK127046-1|BAC86802.1| 1225|Homo sapiens protein ( Homo sapiens ...    37   0.072
AF425231-1|AAL98962.1| 1954|Homo sapiens chromodomain helicase D...    37   0.072
BC146785-1|AAI46786.1| 1556|Homo sapiens INOC1 protein protein.        37   0.095
AB033085-1|BAA86573.1| 1561|Homo sapiens KIAA1259 protein protein.     37   0.095
U91543-1|AAC39923.1| 2000|Homo sapiens zinc-finger helicase prot...    36   0.13 
AY647157-1|AAT66509.1| 2881|Homo sapiens KISH2 protein.                36   0.13 
AY243500-1|AAQ24287.1| 2897|Homo sapiens chromatin remodeling fa...    36   0.13 
AF006515-1|AAB87383.1| 1944|Homo sapiens CHD3 protein.                 36   0.13 
AB002306-1|BAA20767.3| 2759|Homo sapiens KIAA0308 protein.             36   0.13 
DQ333316-1|ABD24032.1| 2881|Homo sapiens PRIC320 isoform 1 protein.    36   0.17 
DQ059482-1|AAY87153.1| 1995|Homo sapiens ciprofibrate bound prot...    36   0.17 
AK022582-1|BAB14112.1|  730|Homo sapiens protein ( Homo sapiens ...    36   0.17 
AK026022-1|BAB15325.1|  757|Homo sapiens protein ( Homo sapiens ...    35   0.29 
AK022240-1|BAB13994.1|  336|Homo sapiens protein ( Homo sapiens ...    35   0.29 
AB037756-1|BAA92573.2| 2041|Homo sapiens KIAA1335 protein protein.     35   0.29 
X86691-1|CAA60384.1| 1912|Homo sapiens Mi-2 protein protein.           34   0.51 
BX538033-1|CAD97978.1|  822|Homo sapiens hypothetical protein pr...    34   0.51 
BC038596-1|AAH38596.1| 1937|Homo sapiens CHD4 protein protein.         34   0.51 
AL138759-1|CAD13191.1|  838|Homo sapiens helicase, lymphoid-spec...    34   0.51 
AF155827-1|AAF82262.1|  838|Homo sapiens proliferation-associate...    34   0.51 
AB113249-1|BAD24805.1|  782|Homo sapiens lymphoid specific helic...    34   0.51 
AB113248-1|BAD24804.1|  809|Homo sapiens lymphoid specific helic...    34   0.51 
AB102718-1|BAD10846.1|  806|Homo sapiens lymphoid specific helic...    34   0.51 
BC031004-1|AAH31004.1|  348|Homo sapiens HELLS protein protein.        33   0.89 
BC030963-1|AAH30963.1|  348|Homo sapiens HELLS protein protein.        33   0.89 
BC029381-1|AAH29381.1|  348|Homo sapiens HELLS protein protein.        33   0.89 
BC015477-1|AAH15477.1|  317|Homo sapiens HELLS protein protein.        33   0.89 
AY007108-1|AAG01987.1|  348|Homo sapiens protein ( Homo sapiens ...    33   0.89 
AL138759-4|CAH70224.1|  310|Homo sapiens helicase, lymphoid-spec...    33   0.89 
AK001201-1|BAA91550.1|  310|Homo sapiens protein ( Homo sapiens ...    33   0.89 
AB102723-1|BAD10851.1|  884|Homo sapiens lymphoid specific helic...    33   0.89 
AB102721-1|BAD10849.1|  740|Homo sapiens lymphoid specific helic...    33   0.89 
AB102719-1|BAD10847.1|  708|Homo sapiens lymphoid specific helic...    33   0.89 
AB074174-1|BAE45737.1|  372|Homo sapiens putative protein produc...    33   0.89 
BC112201-1|AAI12202.1| 1849|Homo sapiens BTAF1 RNA polymerase II...    33   1.2  
BC029930-1|AAH29930.1|  680|Homo sapiens BTAF1 protein protein.        33   1.2  
AL365398-1|CAI14103.1| 1849|Homo sapiens BTAF1 RNA polymerase II...    33   1.2  
AL359198-2|CAH73478.1| 1849|Homo sapiens BTAF1 RNA polymerase II...    33   1.2  
AJ001017-1|CAA04475.1| 1849|Homo sapiens TBP associated factor p...    33   1.2  
AF038362-1|AAC04573.1| 1849|Homo sapiens TBP-associated factor 1...    33   1.2  
AB208843-1|BAD92080.1|  699|Homo sapiens BTAF1 RNA polymerase II...    33   1.2  
AB007913-1|BAA32289.1|  978|Homo sapiens KIAA0444 protein protein.     33   1.6  
Z84487-2|CAI42674.1| 2492|Homo sapiens alpha thalassemia/mental ...    32   2.7  
Z84487-1|CAI42675.1| 2454|Homo sapiens alpha thalassemia/mental ...    32   2.7  
U97103-1|AAC51657.1| 2375|Homo sapiens X-linked nuclear protein ...    32   2.7  
U75653-1|AAC51655.1| 2492|Homo sapiens zinc finger helicase prot...    32   2.7  
U72938-1|AAB49971.2| 2454|Homo sapiens putative DNA dependent AT...    32   2.7  
U72937-1|AAB49970.2| 2492|Homo sapiens putative DNA dependent AT...    32   2.7  
U72936-1|AAB49969.1| 2288|Homo sapiens putative DNA dependent AT...    32   2.7  
U72935-3|AAB40700.1| 2288|Homo sapiens putative DNA dependent AT...    32   2.7  
U72935-2|AAB40699.1| 2337|Homo sapiens putative DNA dependent AT...    32   2.7  
U72935-1|AAB40698.1| 2375|Homo sapiens putative DNA dependent AT...    32   2.7  
U09820-1|AAC50069.1| 1641|Homo sapiens helicase II protein.            32   2.7  
L34363-1|AAA20872.1| 1298|Homo sapiens X-linked nuclear protein ...    32   2.7  
EF467914-1|ABO43036.1| 2492|Homo sapiens alpha thalassemia/menta...    32   2.7  
AL121874-2|CAI40710.1| 2492|Homo sapiens alpha thalassemia/menta...    32   2.7  
AL121874-1|CAB90351.2| 2454|Homo sapiens alpha thalassemia/menta...    32   2.7  
AL109753-2|CAI43115.1| 2492|Homo sapiens alpha thalassemia/menta...    32   2.7  
AL109753-1|CAI43116.1| 2454|Homo sapiens alpha thalassemia/menta...    32   2.7  
AK027490-1|BAB55150.1|  702|Homo sapiens protein ( Homo sapiens ...    32   2.7  
AB102641-1|BAC81110.1| 2492|Homo sapiens ATRX protein.                 32   2.7  
EU069463-1|ABU25227.1| 1250|Homo sapiens Plk1-interacting checkp...    31   4.7  
BC111486-1|AAI11487.1| 1250|Homo sapiens excision repair cross-c...    31   4.7  
AK074719-1|BAC11160.1| 1106|Homo sapiens protein ( Homo sapiens ...    31   4.7  
X97668-1|CAA66258.1|  815|Homo sapiens XLRP3 protein.                  31   6.3  
U57629-1|AAC50481.1|  815|Homo sapiens retinitis pigmentosa GTPa...    31   6.3  
AL606748-2|CAI95407.1|  815|Homo sapiens retinitis pigmentosa GT...    31   6.3  
AK223491-1|BAD97211.1|  815|Homo sapiens retinitis pigmentosa GT...    31   6.3  
AJ318463-1|CAC86116.1|  815|Homo sapiens retinitis pigmentosa GT...    31   6.3  
BC024298-1|AAH24298.1| 1359|Homo sapiens RAD54-like 2 (S. cerevi...    30   8.3  
BC001474-1|AAH01474.2| 1159|Homo sapiens RAD54L2 protein protein.      30   8.3  
AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein KI...    30   8.3  
AB018352-1|BAA34529.2| 1385|Homo sapiens KIAA0809 protein protein.     30   8.3  
AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein.     30   8.3  

>AB209845-1|BAD93082.1|  165|Homo sapiens transcription termination
           factor, RNA polymerase II variant protein.
          Length = 165

 Score = 61.7 bits (143), Expect = 3e-09
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 39  LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 98

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKKRCTIS 287
           ++L+R K ++        +++V V    + +  T+S
Sbjct: 99  LLLRRTKDQLDSTGRPLVIKFVPVPGGGQGRNMTVS 134


>AL445231-3|CAH71961.1| 1162|Homo sapiens transcription termination
           factor, RNA polymerase II protein.
          Length = 1162

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 756 LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 815

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 816 LLLRRTKDQL 825



 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N++  K ++VSQW   LK+     K+  +      G +  + R+     FN++   Q  +
Sbjct: 1006 NSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--V 1063

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
            +L+S+  GGVGLNL GGN L
Sbjct: 1064 MLISLLAGGVGLNLTGGNHL 1083


>AL391476-7|CAI12738.1| 1162|Homo sapiens transcription termination
           factor, RNA polymerase II protein.
          Length = 1162

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 756 LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 815

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 816 LLLRRTKDQL 825



 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N++  K ++VSQW   LK+     K+  +      G +  + R+     FN++   Q  +
Sbjct: 1006 NSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--V 1063

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
            +L+S+  GGVGLNL GGN L
Sbjct: 1064 MLISLLAGGVGLNLTGGNHL 1083


>AF080255-1|AAD49435.1| 1162|Homo sapiens lodestar protein protein.
          Length = 1162

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 756 LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 815

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 816 LLLRRTKDQL 825



 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N++  K ++VSQW   LK+     K+  +      G +  + R+     FN++   Q  +
Sbjct: 1006 NSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--V 1063

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
            +L+S+  GGVGLNL GGN L
Sbjct: 1064 MLISLLAGGVGLNLTGGNHL 1083


>AF073771-1|AAC64044.1| 1162|Homo sapiens RNA polymerase II
           termination factor protein.
          Length = 1162

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 756 LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 815

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 816 LLLRRTKDQL 825



 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N++  K ++VSQW   LK+     K+  +      G +  + R+     FN++   Q  +
Sbjct: 1006 NSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--V 1063

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
            +L+S+  GGVGLNL GGN L
Sbjct: 1064 MLISLLAGGVGLNLTGGNHL 1083


>Z46606-2|CAA86572.1|  887|Homo sapiens helicase-like transcription
           factor protein.
          Length = 887

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 454 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 513

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 514 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 554



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
           ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 712 KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 771

Query: 667 ETTFNNAADTQHRILLLSIKCGGVGLNL 750
              F N       I+LLS++ GGVGLNL
Sbjct: 772 IQCFQNTEAGSPTIMLLSLRAGGVGLNL 799



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 549 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 599


>Z46606-1|CAA86571.1| 1009|Homo sapiens helicase-like transcription
           factor protein.
          Length = 1009

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 576 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 635

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 636 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 676



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 834  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 893

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS++ GGVGLNL
Sbjct: 894  IQCFQNTEAGSPTIMLLSLRAGGVGLNL 921



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 671 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 721


>L34673-1|AAA67436.1| 1009|Homo sapiens ATPase protein.
          Length = 1009

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 576 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 635

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 636 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 676



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 834  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 893

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS+K GGVGLNL
Sbjct: 894  IQCFQNTEAGSPTIMLLSLKAGGVGLNL 921



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 671 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 721


>BC044659-1|AAH44659.1| 1008|Homo sapiens helicase-like
           transcription factor protein.
          Length = 1008

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 575 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 634

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 635 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 675



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 833  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 892

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS+K GGVGLNL
Sbjct: 893  IQCFQNTEAGSPTIMLLSLKAGGVGLNL 920



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 670 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 720


>AJ418064-1|CAD10805.1| 1009|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1009

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 576 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 635

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 636 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 676



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 834  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 893

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS++ GGVGLNL
Sbjct: 894  IQCFQNTEAGSPTIMLLSLRAGGVGLNL 921



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 671 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 721


>AB209052-1|BAD92289.1|  992|Homo sapiens SWI/SNF-related
           matrix-associated actin-dependent regulator of chromatin
           a3 var protein.
          Length = 992

 Score = 53.6 bits (123), Expect = 8e-07
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 576 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 635

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 636 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 676



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 834  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 893

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS+K GGVGLNL
Sbjct: 894  IQCFQNTEAGSPTIMLLSLKAGGVGLNL 921



 Score = 36.7 bits (81), Expect = 0.095
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 671 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 721


>X97795-1|CAA66379.1|  747|Homo sapiens RAD54 protein.
          Length = 747

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>BC121060-1|AAI21061.1|  747|Homo sapiens RAD54-like (S. cerevisiae)
           protein.
          Length = 747

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>BC121059-1|AAI21060.1|  747|Homo sapiens RAD54-like (S. cerevisiae)
           protein.
          Length = 747

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>AY623117-1|AAT38113.1|  747|Homo sapiens RAD54-like (S. cerevisiae)
           protein.
          Length = 747

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>AL121602-1|CAI22117.1|  747|Homo sapiens RAD54-like (S. cerevisiae)
           protein.
          Length = 747

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator
            protein.
          Length = 1647

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator
            hSNF2b protein.
          Length = 1647

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix
            associated, actin dependent regulator of chromatin, sub
            protein.
          Length = 1647

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.
          Length = 1647

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.
          Length = 1679

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>AC006127-2|AAC97987.1|  661|Homo sapiens SN24_HUMAN protein.
          Length = 661

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 279 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 337

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LLS + GG+GLNL   +T+
Sbjct: 338 IFLLSTRAGGLGLNLQSADTV 358



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
           A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 90  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 149

Query: 153 ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
               R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 150 LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 182


>AC006127-1|AAC97986.1|  628|Homo sapiens BRG-1-HUMAN  [AA 812-1440]
           protein.
          Length = 628

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 279 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 337

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LLS + GG+GLNL   +T+
Sbjct: 338 IFLLSTRAGGLGLNLQSADTV 358



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
           A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 90  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 149

Query: 153 ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
               R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 150 LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 182


>AB209313-1|BAD92550.1| 1164|Homo sapiens SWI/SNF-related
            matrix-associated actin-dependent regulator of chromatin
            a4 var protein.
          Length = 1164

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1049 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1107

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1108 IFLLSTRAGGLGLNLQSADTV 1128



 Score = 35.5 bits (78), Expect = 0.22
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 860  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 919

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 920  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 952


>X72889-1|CAA51407.1| 1586|Homo sapiens HBRM protein.
          Length = 1586

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1058 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1116

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1117 IFLLSTRAGGLGLNLQAADTV 1137



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 869  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 928

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 929  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 961


>D26155-1|BAA05142.1| 1572|Homo sapiens transcriptional activator
            hSNF2a protein.
          Length = 1572

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1062 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1121 IFLLSTRAGGLGLNLQAAHTV 1141



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 873  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 932

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 933  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 965


>BC001965-1|AAH01965.1|  910|Homo sapiens RAD54 homolog B (S.
           cerevisiae) protein.
          Length = 910

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 29/76 (38%), Positives = 40/76 (52%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K++LVS + + L I +   K+   A     GQ  +  R      FN+   +   I LLS
Sbjct: 661 EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQ-HSSFFIFLLS 719

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNLIGG+ L
Sbjct: 720 SKAGGVGLNLIGGSHL 735


>AL359076-4|CAI12968.1| 1572|Homo sapiens SWI/SNF related, matrix
            associated, actin dependent regulator of chromatin, sub
            protein.
          Length = 1572

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1062 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1121 IFLLSTRAGGLGLNLQAADTV 1141



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 873  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 932

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 933  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 965


>AL359076-3|CAI12967.1| 1590|Homo sapiens SWI/SNF related, matrix
            associated, actin dependent regulator of chromatin, sub
            protein.
          Length = 1590

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1062 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1121 IFLLSTRAGGLGLNLQAADTV 1141



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 873  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 932

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 933  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 965


>AL138755-9|CAI14600.1| 1572|Homo sapiens SWI/SNF related, matrix
            associated, actin dependent regulator of chromatin, sub
            protein.
          Length = 1572

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1062 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1121 IFLLSTRAGGLGLNLQAADTV 1141



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 873  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 932

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 933  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 965


>AL138755-8|CAI14599.1| 1590|Homo sapiens SWI/SNF related, matrix
            associated, actin dependent regulator of chromatin, sub
            protein.
          Length = 1590

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ +++L  Q    + I E++F  +N   L   G  K EDR      FN    +Q+ 
Sbjct: 1062 LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPG-SQYF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1121 IFLLSTRAGGLGLNLQAADTV 1141



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 873  APRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETI 932

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 933  LIIRRLHKVLRPFLLRRLKKEVESQLPE-KVEYV 965


>AL133578-1|CAB63724.1|  580|Homo sapiens hypothetical protein
           protein.
          Length = 580

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 29/76 (38%), Positives = 40/76 (52%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K++LVS + + L I +   K+   A     GQ  +  R      FN+   +   I LLS
Sbjct: 331 EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQ-HSSFFIFLLS 389

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNLIGG+ L
Sbjct: 390 SKAGGVGLNLIGGSHL 405


>AF112481-1|AAD34331.1|  910|Homo sapiens RAD54B protein protein.
          Length = 910

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 29/76 (38%), Positives = 40/76 (52%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K++LVS + + L I +   K+   A     GQ  +  R      FN+   +   I LLS
Sbjct: 661 EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQ-HSSFFIFLLS 719

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNLIGG+ L
Sbjct: 720 SKAGGVGLNLIGGSHL 735


>EF560738-1|ABQ59048.1|  900|Homo sapiens CHD1L protein protein.
          Length = 900

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 204 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 263

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 264 RVKAEVATELPKKTEVVIYHGMSALQKK 291



 Score = 38.3 bits (85), Expect = 0.031
 Identities = 22/81 (27%), Positives = 40/81 (49%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L +   +++L SQ  + L I +++   +  +     G ++ E+R LA     N       
Sbjct: 362 LYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---IKNFGQQPIF 418

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GGVG+NL   +T+
Sbjct: 419 VFLLSTRAGGVGMNLTAADTV 439


>BC043501-1|AAH43501.1|  890|Homo sapiens Similar to RIKEN cDNA
           4432404A22 gene protein.
          Length = 890

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 194 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 253

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 254 RVKAEVATELPKKTEVVIYHGMSALQKK 281



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 343 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 399

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 400 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 429


>BC005038-1|AAH05038.1|  789|Homo sapiens CHD1L protein protein.
          Length = 789

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 187 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 246

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 247 RVKAEVATELPKKTEVVIYHGMSALQKK 274


>BC001171-1|AAH01171.1|  896|Homo sapiens Unknown (protein for
           IMAGE:3355762) protein.
          Length = 896

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 200 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 259

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 260 RVKAEVATELPKKTEVVIYHGMSALQKK 287



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 349 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 405

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 406 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 435


>AL356378-7|CAH72650.1|  897|Homo sapiens chromodomain helicase DNA
           binding protein 1-like protein.
          Length = 897

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 201 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 260

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 261 RVKAEVATELPKKTEVVIYHGMSALQKK 288



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 350 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 406

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 407 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 436


>AK223496-1|BAD97216.1|  702|Homo sapiens chromodomain helicase DNA
           binding protein 1-like variant protein.
          Length = 702

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 105 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 164

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 165 RVKAEVATELPKKTEVVIYHGMSALQKK 192



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 254 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 310

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 311 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 340


>AK027631-1|BAB55248.1|  521|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14725 fis, clone NT2RP3001724, highly similar to
           Homo sapiens chromodomain-helicase-DNA-binding protein
           mRNA. ).
          Length = 521

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 88  LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 147

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 148 RVKAEVATELPKKTEVVIYHGMSALQKK 175



 Score = 38.7 bits (86), Expect = 0.024
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 237 HLLDKLLAFLYSGGHRVLLFSQMTQMLDIPQDYMDYRGYSYERVDGSVRGEERHLA---I 293

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 294 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 323


>AK001342-1|BAA91637.1|  831|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10480 fis, clone NT2RP2000126, weakly similar to
           POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L. ).
          Length = 831

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 201 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 260

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 261 RVKAEVATELPKKTEVVIYHGMSALQKK 288



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 350 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 406

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 407 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 436


>AF537213-1|AAO49505.1|  897|Homo sapiens ALC1 protein.
          Length = 897

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 201 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 260

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 261 RVKAEVATELPKKTEVVIYHGMSALQKK 288



 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 350 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 406

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 407 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 436


>BC045534-1|AAH45534.1| 1028|Homo sapiens SWI/SNF-related,
            matrix-associated actin-dependent regulator of chromatin,
            subf protein.
          Length = 1028

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    D+++L SQ+   L I E   K      L   G+ ++ +RI     FN   D    
Sbjct: 868  LKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIF-- 925

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG+G+NL   N +
Sbjct: 926  VFLLSTKAGGLGINLTSANVV 946



 Score = 37.5 bits (83), Expect = 0.055
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP-----RVWKMLNKNNDSTN----- 155
           + A NR  +TGTP+ N   ++ S++NF+    F+       R++    K+ D  +     
Sbjct: 647 INANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKE 706

Query: 156 RI---KSIIKKIVLKRDKSEISFNIP 224
           RI   K IIK  +L+R K E+   +P
Sbjct: 707 RIAHAKQIIKPFILRRVKEEVLKQLP 732


>AY008271-1|AAG16639.1| 1026|Homo sapiens helicase SMARCAD1 protein.
          Length = 1026

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    D+++L SQ+   L I E   K      L   G+ ++ +RI     FN   D    
Sbjct: 866  LKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIF-- 923

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG+G+NL   N +
Sbjct: 924  VFLLSTKAGGLGINLTSANVV 944



 Score = 37.5 bits (83), Expect = 0.055
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP-----RVWKMLNKNNDSTN----- 155
           + A NR  +TGTP+ N   ++ S++NF+    F+       R++    K+ D  +     
Sbjct: 647 INANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKE 706

Query: 156 RI---KSIIKKIVLKRDKSEISFNIP 224
           RI   K IIK  +L+R K E+   +P
Sbjct: 707 RIAHAKQIIKPFILRRVKEEVLKQLP 732


>AB032948-1|BAA86436.1| 1048|Homo sapiens KIAA1122 protein protein.
          Length = 1048

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    D+++L SQ+   L I E   K      L   G+ ++ +RI     FN   D    
Sbjct: 888  LKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIF-- 945

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG+G+NL   N +
Sbjct: 946  VFLLSTKAGGLGINLTSANVV 966



 Score = 37.5 bits (83), Expect = 0.055
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP-----RVWKMLNKNNDSTN----- 155
           + A NR  +TGTP+ N   ++ S++NF+    F+       R++    K+ D  +     
Sbjct: 667 INANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKE 726

Query: 156 RI---KSIIKKIVLKRDKSEISFNIP 224
           RI   K IIK  +L+R K E+   +P
Sbjct: 727 RIAHAKQIIKPFILRRVKEEVLKQLP 752


>BC023144-1|AAH23144.1| 1052|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1052

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +3

Query: 15  TNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK---NNDSTNRIKSIIK 176
           TNR  +TGTP+ N   +++S++NFL    FN   D   W   N    +     R+  +++
Sbjct: 330 TNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLR 389

Query: 177 KIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             +L+R K+++  ++P      ++V L K ++
Sbjct: 390 PFLLRRIKADVEKSLPPKKEVKIYVGLSKMQR 421



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 19/75 (25%), Positives = 36/75 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   ++R  +   +N    T+  
Sbjct: 495 LKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKF- 553

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 554 VFMLSTRAGGLGINL 568


>AC099396-1|AAY40920.1|  367|Homo sapiens unknown protein.
          Length = 367

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +3

Query: 15  TNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK---NNDSTNRIKSIIK 176
           TNR  +TGTP+ N   +++S++NFL    FN   D   W   N    +     R+  +++
Sbjct: 63  TNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLR 122

Query: 177 KIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             +L+R K+++  ++P      ++V L K ++
Sbjct: 123 PFLLRRIKADVEKSLPPKKEVKIYVGLSKMQR 154



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 19/75 (25%), Positives = 36/75 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   ++R  +   +N    T+  
Sbjct: 228 LKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKF- 286

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 287 VFMLSTRAGGLGINL 301


>AB010882-1|BAA25173.1| 1052|Homo sapiens hSNF2H protein.
          Length = 1052

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +3

Query: 15  TNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK---NNDSTNRIKSIIK 176
           TNR  +TGTP+ N   +++S++NFL    FN   D   W   N    +     R+  +++
Sbjct: 330 TNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLR 389

Query: 177 KIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             +L+R K+++  ++P      ++V L K ++
Sbjct: 390 PFLLRRIKADVEKSLPPKKEVKIYVGLSKMQR 421



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 19/75 (25%), Positives = 36/75 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   ++R  +   +N    T+  
Sbjct: 495 LKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKF- 553

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 554 VFMLSTRAGGLGINL 568


>AY034072-1|AAK56405.1| 2713|Homo sapiens chromodomain helicase DNA
           binding protein 5 protein.
          Length = 2713

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-----KNNDSTNRIKSIIKKIVLKR 194
           +TGTP+ N   +++S++NFL+  P   P     L      K  +   +++SI+K ++L+R
Sbjct: 623 LTGTPLQNSVEELFSLLNFLE--PSQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRR 680

Query: 195 DKSEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            K ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 681 LKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKN 716



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 799  KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 857

Query: 724  KCGGVGLNLIGGNT 765
            + GG+G+NL   +T
Sbjct: 858  RAGGLGINLTAADT 871


>AL121674-2|CAI21744.1| 2715|Homo sapiens chromodomain helicase DNA
           binding protein 6 protein.
          Length = 2715

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-----KNNDSTNRIKSIIKKIVLKR 194
           +TGTP+ N   +++S++NFL+  P   P     L      K  +   +++SI+K ++L+R
Sbjct: 625 LTGTPLQNSVEELFSLLNFLE--PSQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRR 682

Query: 195 DKSEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            K ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 683 LKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKN 718



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 801  KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 859

Query: 724  KCGGVGLNLIGGNT 765
            + GG+G+NL   +T
Sbjct: 860  RAGGLGINLTAADT 873


>AL031669-3|CAI22255.1| 2715|Homo sapiens chromodomain helicase DNA
           binding protein 6 protein.
          Length = 2715

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-----KNNDSTNRIKSIIKKIVLKR 194
           +TGTP+ N   +++S++NFL+  P   P     L      K  +   +++SI+K ++L+R
Sbjct: 625 LTGTPLQNSVEELFSLLNFLE--PSQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRR 682

Query: 195 DKSEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            K ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 683 LKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKN 718



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 801  KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 859

Query: 724  KCGGVGLNLIGGNT 765
            + GG+G+NL   +T
Sbjct: 860  RAGGLGINLTAADT 873


>AL031667-2|CAI42977.1| 2715|Homo sapiens chromodomain helicase DNA
           binding protein 6 protein.
          Length = 2715

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-----KNNDSTNRIKSIIKKIVLKR 194
           +TGTP+ N   +++S++NFL+  P   P     L      K  +   +++SI+K ++L+R
Sbjct: 625 LTGTPLQNSVEELFSLLNFLE--PSQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRR 682

Query: 195 DKSEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            K ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 683 LKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKN 718



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 801  KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 859

Query: 724  KCGGVGLNLIGGNT 765
            + GG+G+NL   +T
Sbjct: 860  RAGGLGINLTAADT 873


>M89907-1|AAA80560.1|  769|Homo sapiens transcription activator
           protein.
          Length = 769

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424


>M88163-1|AAA80559.1|  976|Homo sapiens transcription activator
           protein.
          Length = 976

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 254 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 313

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 314 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 346


>BC117686-1|AAI17687.1| 1683|Homo sapiens SHPRH protein protein.
          Length = 1683

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
            L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 838  LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 897

Query: 177  KIVLKRDKSEI--SFNIPKHTVE 239
            KI+ +  K ++     IP  T E
Sbjct: 898  KILWRSAKKDVIDQIQIPPQTEE 920


>BC117447-1|AAI17448.1| 1054|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1054

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424


>BC052963-1|AAH52963.1| 1394|Homo sapiens SRCAP protein protein.
          Length = 1394

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
           ++QT A L+   L     ++++ +Q    L + E F        L   G  +VE R    
Sbjct: 208 KLQTLAVLLRQ-LKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALM 266

Query: 670 TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             FN  AD +    +LS + GGVG+NL G +T+
Sbjct: 267 ERFN--ADKRIFCFILSTRSGGVGVNLTGADTV 297


>AY163808-1|AAO06907.1| 1659|Homo sapiens helicase-like protein
            protein.
          Length = 1659

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
            L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 838  LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 897

Query: 177  KIVLKRDKSEI--SFNIPKHTVE 239
            KI+ +  K ++     IP  T E
Sbjct: 898  KILWRSAKKDVIDQIQIPPQTEE 920


>AY161136-1|AAO26201.1| 1683|Homo sapiens SNF2 histone linker PHD RING
            helicase protein.
          Length = 1683

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
            L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 838  LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 897

Query: 177  KIVLKRDKSEI--SFNIPKHTVE 239
            KI+ +  K ++     IP  T E
Sbjct: 898  KILWRSAKKDVIDQIQIPPQTEE 920


>AL451145-1|CAH70765.1| 1683|Homo sapiens SNF2 histone linker PHD RING
            helicase protein.
          Length = 1683

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
            L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 838  LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 897

Query: 177  KIVLKRDKSEI--SFNIPKHTVE 239
            KI+ +  K ++     IP  T E
Sbjct: 898  KILWRSAKKDVIDQIQIPPQTEE 920


>AL356599-2|CAI41120.1| 1683|Homo sapiens SNF2 histone linker PHD RING
            helicase protein.
          Length = 1683

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
            L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 838  LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 897

Query: 177  KIVLKRDKSEI--SFNIPKHTVE 239
            KI+ +  K ++     IP  T E
Sbjct: 898  KILWRSAKKDVIDQIQIPPQTEE 920


>AL138745-3|CAI42614.1| 1005|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1005

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 311 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 370

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 371 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 403


>AL138745-2|CAI42612.1| 1042|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1042

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424



 Score = 37.5 bits (83), Expect = 0.055
 Identities = 22/81 (27%), Positives = 38/81 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +        GQ   E+R  A   FN A ++   
Sbjct: 498 LKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREEAIEAFN-APNSSKF 556

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I +LS + GG+G+NL   + +
Sbjct: 557 IFMLSTRAGGLGINLASADVV 577


>AL138745-1|CAI42613.1| 1054|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1054

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424


>AL022577-3|CAI42684.1| 1005|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1005

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 311 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 370

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 371 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 403


>AL022577-2|CAI42682.1| 1042|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1042

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424



 Score = 37.5 bits (83), Expect = 0.055
 Identities = 22/81 (27%), Positives = 38/81 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +        GQ   E+R  A   FN A ++   
Sbjct: 498 LKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREEAIEAFN-APNSSKF 556

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I +LS + GG+G+NL   + +
Sbjct: 557 IFMLSTRAGGLGINLASADVV 577


>AL022577-1|CAI42683.1| 1054|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1054

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW---KMLNKNNDSTNRIKSII 173
           +TNR  +TGTP+ N   ++++++NFL    FN   D   W   K    +     R+ +++
Sbjct: 332 STNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVL 391

Query: 174 KKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           K  +L+R K+++  ++P      +++ L K ++
Sbjct: 392 KPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQR 424


>AK128030-1|BAC87237.1| 2427|Homo sapiens protein ( Homo sapiens cDNA
            FLJ46149 fis, clone TESTI4000621, moderately  similar to
            Homo sapiens Snf2-related CBP activator protein (SRCAP).
            ).
          Length = 2427

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT A L+   L     ++++ +Q    L + E F        L   G  +VE R    
Sbjct: 2044 KLQTLAVLLRQ-LKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALM 2102

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN  AD +    +LS + GGVG+NL G +T+
Sbjct: 2103 ERFN--ADKRIFCFILSTRSGGVGVNLTGADTV 2133



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 13/99 (13%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------ML----NKNNDSTNRI 161
            R  +TGTP+ N   +++S+++FL    F   R +K         M+      N     R+
Sbjct: 770  RLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRL 829

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKRC 278
              +++  +L+R K ++   +PK   E+V    + K++RC
Sbjct: 830  HKVLRPFLLRRVKVDVEKQMPK-KYEHVIRCRLSKRQRC 867


>AK023990-1|BAB14759.1|  361|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13928 fis, clone Y79AA1000705, moderately
           similar to M.musculus mRNA of enhancer-trap-locus 1. ).
          Length = 361

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/81 (30%), Positives = 38/81 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L    D+++L SQ+   L I E   K      L   G+ ++ +RI     FN   D    
Sbjct: 201 LKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIF-- 258

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS K GG+G++L   N +
Sbjct: 259 VFLLSTKAGGLGIDLTSANVV 279


>AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activator
            SRCAP protein.
          Length = 2971

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT A L+   L     ++++ +Q    L + E F        L   G  +VE R    
Sbjct: 1785 KLQTLAVLLRQ-LKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALM 1843

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN  AD +    +LS + GGVG+NL G +T+
Sbjct: 1844 ERFN--ADKRIFCFILSTRSGGVGVNLTGADTV 1874



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 13/99 (13%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------ML----NKNNDSTNRI 161
           R  +TGTP+ N   +++S+++FL    F   R +K         M+      N     R+
Sbjct: 573 RLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRL 632

Query: 162 KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKRC 278
             +++  +L+R K ++   +PK   E+V    + K++RC
Sbjct: 633 HKVLRPFLLRRVKVDVEKQMPK-KYEHVIRCRLSKRQRC 670


>AB095943-1|BAC23119.1| 1092|Homo sapiens KIAA2023 protein protein.
          Length = 1092

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTN--RIKSIIK 176
           L+  NRWCI+GTP+     D++ ++ FL   P+     W ++L +     N   + S I 
Sbjct: 423 LSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIA 482

Query: 177 KIVLKRDKSEI--SFNIPKHTVE 239
           KI+ +  K ++     IP  T E
Sbjct: 483 KILWRSAKKDVIDQIQIPPQTEE 505


>AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.
          Length = 3053

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT A L+   L     ++++ +Q    L + E F        L   G  +VE R    
Sbjct: 1867 KLQTLAVLLRQ-LKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALM 1925

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN  AD +    +LS + GGVG+NL G +T+
Sbjct: 1926 ERFN--ADKRIFCFILSTRSGGVGVNLTGADTV 1956



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 13/99 (13%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------ML----NKNNDSTNRI 161
            R  +TGTP+ N   +++S+++FL    F   R +K         M+      N     R+
Sbjct: 751  RLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRL 810

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKRC 278
              +++  +L+R K ++   +PK   E+V    + K++RC
Sbjct: 811  HKVLRPFLLRRVKVDVEKQMPK-KYEHVIRCRLSKRQRC 848


>BC035183-1|AAH35183.1|  523|Homo sapiens LOC375748 protein protein.
          Length = 523

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK++L S   + L + + +     +      G  K E+R+     FN+  D    I L+S
Sbjct: 347 DKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVN--ICLVS 404

Query: 721 IKCGGVGLNLIGGNTL 768
              GG+GLN +G N +
Sbjct: 405 TMAGGLGLNFVGANVV 420


>AL161454-5|CAI16517.1|  712|Homo sapiens chromosome 9 open reading
           frame 102 protein.
          Length = 712

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK++L S   + L + + +     +      G  K E+R+     FN+  D    I L+S
Sbjct: 536 DKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVN--ICLVS 593

Query: 721 IKCGGVGLNLIGGNTL 768
              GG+GLN +G N +
Sbjct: 594 TMAGGLGLNFVGANVV 609


>AL161454-4|CAO03518.1|  365|Homo sapiens chromosome 9 open reading
           frame 102 protein.
          Length = 365

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK++L S   + L + + +     +      G  K E+R+     FN+  D    I L+S
Sbjct: 218 DKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVN--ICLVS 275

Query: 721 IKCGGVGLNLIGGNTL 768
              GG+GLN +G N +
Sbjct: 276 TMAGGLGLNFVGANVV 291


>BC077717-1|AAH77717.1|  693|Homo sapiens CHD1L protein protein.
          Length = 693

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 508 HLVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTF 678
           HL+D +L    +   +++L SQ  + L I +++   +  +     G ++ E+R LA    
Sbjct: 146 HLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---I 202

Query: 679 NNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            N       + LLS + GGVG+NL   +T+
Sbjct: 203 KNFGQQPIFVFLLSTRAGGVGMNLTAADTV 232


>AL389952-1|CAB97530.1|  365|Homo sapiens RAD26L hypothetical
           protein, alternatively spliced product; similar to
           (AF21731 protein.
          Length = 365

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 22/76 (28%), Positives = 35/76 (46%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK++L S   + L + + +     +      G  K E+R+     FN+  D    I L S
Sbjct: 218 DKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVN--ICLAS 275

Query: 721 IKCGGVGLNLIGGNTL 768
              GG+GLN +G N +
Sbjct: 276 TMAGGLGLNFVGANVV 291


>AB046784-1|BAB13390.3| 2432|Homo sapiens KIAA1564 protein protein.
          Length = 2432

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 25/94 (26%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLN--KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++S+++FL+   F ++    K     K  +   ++++I+K ++L+R K
Sbjct: 826  LTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLK 885

Query: 201  SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
             ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 886  EDVEKNLAPKQETIIEVELTNIQKKYYRAILEKN 919



 Score = 37.1 bits (82), Expect = 0.072
 Identities = 22/80 (27%), Positives = 38/80 (47%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     K+++ SQ V  L I E++  Q+        G+++   R  A   F+   D+   
Sbjct: 996  LKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKP-DSDRF 1054

Query: 706  ILLLSIKCGGVGLNLIGGNT 765
            + LL  + GG+G+NL   +T
Sbjct: 1055 VFLLCTRAGGLGINLTAADT 1074


>L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein
            protein.
          Length = 1493

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 38/80 (47%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            I +    +++L SQ  + L I E F + +    L   G   +  R    T +N   DT  
Sbjct: 850  IWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNE--DTSI 907

Query: 703  RILLLSIKCGGVGLNLIGGN 762
             + LL+ + GG+G+NL G N
Sbjct: 908  FVFLLTTRVGGLGVNLTGAN 927


>BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair
            cross-complementing rodent repair deficiency,
            complementation g protein.
          Length = 1493

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 38/80 (47%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            I +    +++L SQ  + L I E F + +    L   G   +  R    T +N   DT  
Sbjct: 850  IWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNE--DTSI 907

Query: 703  RILLLSIKCGGVGLNLIGGN 762
             + LL+ + GG+G+NL G N
Sbjct: 908  FVFLLTTRVGGLGVNLTGAN 927


>BC117134-1|AAI17135.1| 1709|Homo sapiens chromodomain helicase DNA
            binding protein 1 protein.
          Length = 1709

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    +++++ SQ V  L I   + K +        G +K E R  A   FN A  ++  
Sbjct: 800  LRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFN-AEGSEDF 858

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 859  CFLLSTRAGGLGINLASADTV 879


>AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair
            cross-complementing rodent repair deficiency,
            complementation g protein.
          Length = 1493

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 38/80 (47%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            I +    +++L SQ  + L I E F + +    L   G   +  R    T +N   DT  
Sbjct: 850  IWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNE--DTSI 907

Query: 703  RILLLSIKCGGVGLNLIGGN 762
             + LL+ + GG+G+NL G N
Sbjct: 908  FVFLLTTRVGGLGVNLTGAN 927


>AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair
            cross-complementing rodent repairnt regulator of
            chromatin, sub protein.
          Length = 1493

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 38/80 (47%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            I +    +++L SQ  + L I E F + +    L   G   +  R    T +N   DT  
Sbjct: 850  IWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNE--DTSI 907

Query: 703  RILLLSIKCGGVGLNLIGGN 762
             + LL+ + GG+G+NL G N
Sbjct: 908  FVFLLTTRVGGLGVNLTGAN 927


>AF006513-1|AAB87381.1| 1709|Homo sapiens CHD1 protein.
          Length = 1709

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    +++++ SQ V  L I   + K +        G +K E R  A   FN A  ++  
Sbjct: 800  LRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFN-AEGSEDF 858

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 859  CFLLSTRAGGLGINLASADTV 879


>AB209504-1|BAD92741.1|  870|Homo sapiens excision repair
           cross-complementing rodent repair deficiency,
           complementation g protein.
          Length = 870

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 38/80 (47%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I +    +++L SQ  + L I E F + +    L   G   +  R    T +N   DT  
Sbjct: 227 IWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNE--DTSI 284

Query: 703 RILLLSIKCGGVGLNLIGGN 762
            + LL+ + GG+G+NL G N
Sbjct: 285 FVFLLTTRVGGLGVNLTGAN 304


>AB037837-1|BAA92654.1| 1967|Homo sapiens KIAA1416 protein protein.
          Length = 1967

 Score = 39.1 bits (87), Expect = 0.018
 Identities = 24/94 (25%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++S+++FL+   F     +       K  +   ++++I+K ++L+R K
Sbjct: 370 LTGTPLQNTVEELFSLLHFLEPSRFPSETTFMQEFGDLKTEEQVQKLQAILKPMMLRRLK 429

Query: 201 SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            ++  N+ PK    +E    N+ KK  R  +  N
Sbjct: 430 EDVEKNLAPKEETIIEVELTNIQKKYYRAILEKN 463



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/80 (26%), Positives = 38/80 (47%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ V  L I E++  Q+        G+++   R  A   F+   D+   
Sbjct: 540 LKAGGHRVLIFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSKP-DSDRF 598

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           + LL  + GG+G+NL   +T
Sbjct: 599 VFLLCTRAGGLGINLTAADT 618


>AL391476-1|CAI12731.1|  143|Homo sapiens transcription termination
           factor, RNA polymerase II protein.
          Length = 143

 Score = 37.9 bits (84), Expect = 0.041
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +1

Query: 577 LKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIG 756
           LK+     K+  +      G +  + R+     FN++   Q  ++L+S+  GGVGLNL G
Sbjct: 3   LKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--VMLISLLAGGVGLNLTG 60

Query: 757 GNTL 768
           GN L
Sbjct: 61  GNHL 64


>AF006514-1|AAB87382.1| 1739|Homo sapiens CHD2 protein.
          Length = 1739

 Score = 37.5 bits (83), Expect = 0.055
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    +++++ SQ V  L I   +   K+       G +K E R  A   FN A  ++  
Sbjct: 803  LRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFN-ADGSEDF 861

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 862  CFLLSTRAGGLGINLASADTV 882



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 17/93 (18%), Positives = 47/93 (50%), Gaps = 5/93 (5%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNN-----DSTNRIKSIIK 176
           + +R  ITGTP+ N   +++S+++F+    F     W+   +++     +    +  +++
Sbjct: 638 SNHRLLITGTPLQNSLKELWSLLHFIMPEKF---EFWEDFEEDHGKGRENGYQSLHKVLE 694

Query: 177 KIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             +L+R K ++  ++P    + + V +   +K+
Sbjct: 695 PFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQ 727


>AL035406-11|CAI19894.1| 1195|Homo sapiens chromodomain helicase DNA
           binding protein 5 protein.
          Length = 1195

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 390 LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 449

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++  N+P  T   V V L + +K+
Sbjct: 450 ADVFKNMPAKTELIVRVELSQMQKK 474



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 552 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 610

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 611 CFLLSTRAGGLGINLATADTV 631


>AL035406-9|CAI19891.1| 1954|Homo sapiens chromodomain helicase DNA
            binding protein 5 protein.
          Length = 1954

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 874  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 933

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L + +K+
Sbjct: 934  ADVFKNMPAKTELIVRVELSQMQKK 958



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1036 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 1094

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1095 CFLLSTRAGGLGINLATADTV 1115


>AL031847-11|CAI19451.1| 1195|Homo sapiens chromodomain helicase DNA
           binding protein 5 protein.
          Length = 1195

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 390 LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 449

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++  N+P  T   V V L + +K+
Sbjct: 450 ADVFKNMPAKTELIVRVELSQMQKK 474



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 552 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 610

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 611 CFLLSTRAGGLGINLATADTV 631


>AL031847-10|CAI19450.1| 1954|Homo sapiens chromodomain helicase DNA
            binding protein 5 protein.
          Length = 1954

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 874  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 933

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L + +K+
Sbjct: 934  ADVFKNMPAKTELIVRVELSQMQKK 958



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1036 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 1094

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1095 CFLLSTRAGGLGINLATADTV 1115


>AK131077-1|BAC85127.1| 1544|Homo sapiens FLJ00266 protein protein.
          Length = 1544

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 22/80 (27%), Positives = 38/80 (47%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     K+++ SQ V  L I E++  Q+        G+++   R  A   F+   D+   
Sbjct: 108 LKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKP-DSDRF 166

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           + LL  + GG+G+NL   +T
Sbjct: 167 VFLLCTRAGGLGINLTAADT 186


>AK127046-1|BAC86802.1| 1225|Homo sapiens protein ( Homo sapiens cDNA
            FLJ45103 fis, clone BRAWH3032571, moderately  similar to
            Chromodomain helicase-DNA-binding protein 4. ).
          Length = 1225

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 874  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 933

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L + +K+
Sbjct: 934  ADVFKNMPAKTELIVRVELSQMQKK 958



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1036 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 1094

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1095 CFLLSTRAGGLGINLATADTV 1115


>AF425231-1|AAL98962.1| 1954|Homo sapiens chromodomain helicase DNA
            binding protein 5 protein.
          Length = 1954

 Score = 37.1 bits (82), Expect = 0.072
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 874  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 933

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L + +K+
Sbjct: 934  ADVFKNMPAKTELIVRVELSQMQKK 958



 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1036 LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 1094

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1095 CFLLSTRAGGLGINLATADTV 1115


>BC146785-1|AAI46786.1| 1556|Homo sapiens INOC1 protein protein.
          Length = 1556

 Score = 36.7 bits (81), Expect = 0.095
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +   ++++ SQ    + + E +   +    +   G  K+ +R      F N  D    
Sbjct: 1113 LKSQGHRVLIYSQMTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMVADFQNRNDIF-- 1170

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1171 VFLLSTRAGGLGINLTAADTV 1191


>AB033085-1|BAA86573.1| 1561|Homo sapiens KIAA1259 protein protein.
          Length = 1561

 Score = 36.7 bits (81), Expect = 0.095
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +   ++++ SQ    + + E +   +    +   G  K+ +R      F N  D    
Sbjct: 1118 LKSQGHRVLIYSQMTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMVADFQNRNDIF-- 1175

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1176 VFLLSTRAGGLGINLTAADTV 1196


>U91543-1|AAC39923.1| 2000|Homo sapiens zinc-finger helicase protein.
          Length = 2000

 Score = 36.3 bits (80), Expect = 0.13
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 910  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 969

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L   +K+
Sbjct: 970  ADVFKNMPAKTELIVRVELSPMQKK 994



 Score = 32.3 bits (70), Expect = 2.1
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F   +        G +    R  A   FN A   Q  
Sbjct: 1072 LKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFN-APGAQQF 1130

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1131 CFLLSTRAGGLGINLATADTV 1151


>AY647157-1|AAT66509.1| 2881|Homo sapiens KISH2 protein.
          Length = 2881

 Score = 36.3 bits (80), Expect = 0.13
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++S+++FL+   F     +       K  +   ++++I+K ++L+R K
Sbjct: 1024 LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLK 1083

Query: 201  SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
             ++   + PK    +E    N+ KK  R  +  N
Sbjct: 1084 EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 1117



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511  LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 1186 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 1245

Query: 682  NAADTQHRILLLSIKCGGVGLNLIGGNT 765
               D+   + LL  + GG+G+NL   +T
Sbjct: 1246 KP-DSDRFVFLLCTRAGGLGINLTAADT 1272


>AY243500-1|AAQ24287.1| 2897|Homo sapiens chromatin remodeling factor
            CHROM1 protein.
          Length = 2897

 Score = 36.3 bits (80), Expect = 0.13
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++S+++FL+   F     +       K  +   ++++I+K ++L+R K
Sbjct: 1024 LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLK 1083

Query: 201  SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
             ++   + PK    +E    N+ KK  R  +  N
Sbjct: 1084 EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 1117



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511  LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 1186 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 1245

Query: 682  NAADTQHRILLLSIKCGGVGLNLIGGNT 765
               D+   + LL  + GG+G+NL   +T
Sbjct: 1246 KP-DSDRFVFLLCTRAGGLGINLTAADT 1272


>AF006515-1|AAB87383.1| 1944|Homo sapiens CHD3 protein.
          Length = 1944

 Score = 36.3 bits (80), Expect = 0.13
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    FN+    + +  +    D   ++  ++   +L+R K
Sbjct: 910  LTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK 969

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L   +K+
Sbjct: 970  ADVFKNMPAKTELIVRVELSPMQKK 994



 Score = 32.3 bits (70), Expect = 2.1
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F   +        G +    R  A   FN A   Q  
Sbjct: 1072 LKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFN-APGAQQF 1130

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1131 CFLLSTRAGGLGINLATADTV 1151


>AB002306-1|BAA20767.3| 2759|Homo sapiens KIAA0308 protein.
          Length = 2759

 Score = 36.3 bits (80), Expect = 0.13
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++S+++FL+   F     +       K  +   ++++I+K ++L+R K
Sbjct: 901  LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLK 960

Query: 201  SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
             ++   + PK    +E    N+ KK  R  +  N
Sbjct: 961  EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 994



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511  LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 1063 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 1122

Query: 682  NAADTQHRILLLSIKCGGVGLNLIGGNT 765
               D+   + LL  + GG+G+NL   +T
Sbjct: 1123 KP-DSDRFVFLLCTRAGGLGINLTAADT 1149


>DQ333316-1|ABD24032.1| 2881|Homo sapiens PRIC320 isoform 1 protein.
          Length = 2881

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511  LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 1186 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 1245

Query: 682  NAADTQHRILLLSIKCGGVGLNLIGGNT 765
               D+   + LL  + GG+G+NL   +T
Sbjct: 1246 KP-DSDRFVFLLCTRAGGLGINLTAADT 1272



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++S+++FL+   F     +       K  +   +++ I+K ++L+R K
Sbjct: 1024 LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQVILKPMMLRRLK 1083

Query: 201  SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
             ++   + PK    +E    N+ KK  R  +  N
Sbjct: 1084 EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 1117


>DQ059482-1|AAY87153.1| 1995|Homo sapiens ciprofibrate bound protein
           p240 isoform PRIC320-2 protein.
          Length = 1995

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511 LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
           L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 300 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 359

Query: 682 NAADTQHRILLLSIKCGGVGLNLIGGNT 765
              D+   + LL  + GG+G+NL   +T
Sbjct: 360 KP-DSDRFVFLLCTRAGGLGINLTAADT 386



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++S+++FL+   F     +       K  +   +++ I+K ++L+R K
Sbjct: 138 LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQVILKPMMLRRLK 197

Query: 201 SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            ++   + PK    +E    N+ KK  R  +  N
Sbjct: 198 EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 231


>AK022582-1|BAB14112.1|  730|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12520 fis, clone NT2RM2001823, weakly similar to
           CHD1 PROTEIN. ).
          Length = 730

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 511 LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
           L+D +L        K+++ SQ V  L I E++   K        G+++   R  A   F+
Sbjct: 300 LIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFS 359

Query: 682 NAADTQHRILLLSIKCGGVGLNLIGGNT 765
              D+   + LL  + GG+G+NL   +T
Sbjct: 360 KP-DSDRFVFLLCTRAGGLGINLTAADT 386



 Score = 35.1 bits (77), Expect = 0.29
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++S+++FL+   F     +       K  +   +++ I+K ++L+R K
Sbjct: 138 LTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQVILKPMMLRRLK 197

Query: 201 SEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            ++   + PK    +E    N+ KK  R  +  N
Sbjct: 198 EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 231


>AK026022-1|BAB15325.1|  757|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22369 fis, clone HRC06676. ).
          Length = 757

 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 24  KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 82

Query: 724 KCGGVGLNLIGGNT 765
           + GG+G+NL   +T
Sbjct: 83  RAGGLGINLTAADT 96


>AK022240-1|BAB13994.1|  336|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12178 fis, clone MAMMA1000731, weakly similar to
           CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1. ).
          Length = 336

 Score = 35.1 bits (77), Expect = 0.29
 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNND-----STNRIKSIIKKIVLKR 194
           +TGTP+ N   +++S+++FL+  P   P     + +  D        ++++I+K ++L+R
Sbjct: 138 LTGTPLQNTVEELFSLLHFLE--PLRFPSESTFMQEFGDLETEEQVQKLQAILKPMMLRR 195

Query: 195 DKSEISFNI-PKH--TVEYVHVNLMKKKKRCTIS*N 293
            K ++   + PK    +E    N+ KK  R  +  N
Sbjct: 196 LKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKN 231


>AB037756-1|BAA92573.2| 2041|Homo sapiens KIAA1335 protein protein.
          Length = 2041

 Score = 35.1 bits (77), Expect = 0.29
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K+++ SQ V  L I E++  Q+        G+++   R  A   F    D+   + LL  
Sbjct: 127 KVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKP-DSDRFVFLLCT 185

Query: 724 KCGGVGLNLIGGNT 765
           + GG+G+NL   +T
Sbjct: 186 RAGGLGINLTAADT 199


>X86691-1|CAA60384.1| 1912|Homo sapiens Mi-2 protein protein.
          Length = 1912

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1062 LKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFN-APGAQQF 1120

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1121 CFLLSTRAGGLGINLATADTV 1141



 Score = 33.9 bits (74), Expect = 0.67
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    F++    + +  +    D   ++  ++   +L+R K
Sbjct: 900  LTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLK 959

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L   +K+
Sbjct: 960  ADVFKNMPSKTELIVRVELSPMQKK 984


>BX538033-1|CAD97978.1|  822|Homo sapiens hypothetical protein
           protein.
          Length = 822

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 359 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 418

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 419 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 461



 Score = 33.9 bits (74), Expect = 0.67
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 601 KVLLFSQMTSMLDILMDYCHLRDFNFSRLNGSMSYSEREKNMHSFNT--DPEVFIFLVST 658

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 659 RAGGLGINLTAADTV 673


>BC038596-1|AAH38596.1| 1937|Homo sapiens CHD4 protein protein.
          Length = 1937

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 1059 LKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFN-APGAQQF 1117

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1118 CFLLSTRAGGLGINLATADTV 1138



 Score = 33.9 bits (74), Expect = 0.67
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPR--VWKMLN-KNNDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   +++ ++NFL    F++    + +  +    D   ++  ++   +L+R K
Sbjct: 897  LTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLK 956

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++  N+P  T   V V L   +K+
Sbjct: 957  ADVFKNMPSKTELIVRVELSPMQKK 981


>AL138759-1|CAD13191.1|  838|Homo sapiens helicase,
           lymphoid-specific protein.
          Length = 838

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 375 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 434

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 435 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 477



 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 674

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 675 RAGGLGINLTAADTV 689


>AF155827-1|AAF82262.1|  838|Homo sapiens proliferation-associated
           SNF2-like protein protein.
          Length = 838

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 375 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 434

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 435 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 477



 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 674

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 675 RAGGLGINLTAADTV 689


>AB113249-1|BAD24805.1|  782|Homo sapiens lymphoid specific helicase
           variant10 protein.
          Length = 782

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 375 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 434

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 435 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 477



 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 674

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 675 RAGGLGINLTAADTV 689


>AB113248-1|BAD24804.1|  809|Homo sapiens lymphoid specific helicase
           variant9 protein.
          Length = 809

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 375 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 434

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 435 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 477


>AB102718-1|BAD10846.1|  806|Homo sapiens lymphoid specific helicase
           variant3 protein.
          Length = 806

 Score = 34.3 bits (75), Expect = 0.51
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 16/103 (15%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--------------MLNKNNDS 149
           A N+  +TGTP+ N   +++S++NFL    F+D + ++              ++ K  + 
Sbjct: 343 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 402

Query: 150 T--NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
              + +  I+   +L+R KS+++  +P      V+  L KK++
Sbjct: 403 NVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQE 445



 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 585 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 642

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 643 RAGGLGINLTAADTV 657


>BC031004-1|AAH31004.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 184

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 185 RAGGLGINLTAADTV 199


>BC030963-1|AAH30963.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 184

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 185 RAGGLGINLTAADTV 199


>BC029381-1|AAH29381.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 184

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 185 RAGGLGINLTAADTV 199


>BC015477-1|AAH15477.1|  317|Homo sapiens HELLS protein protein.
          Length = 317

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 96  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 153

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 154 RAGGLGINLTAADTV 168


>AY007108-1|AAG01987.1|  348|Homo sapiens protein ( Homo sapiens
           clone TCCCTA00017 mRNA sequence. ).
          Length = 348

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 184

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 185 RAGGLGINLTAADTV 199


>AL138759-4|CAH70224.1|  310|Homo sapiens helicase,
           lymphoid-specific protein.
          Length = 310

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 54  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 111

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 112 RAGGLGINLTAADTV 126


>AK001201-1|BAA91550.1|  310|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10339 fis, clone NT2RM2000740, weakly similar to
           POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L. ).
          Length = 310

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 54  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 111

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 112 RAGGLGINLTAADTV 126


>AB102723-1|BAD10851.1|  884|Homo sapiens lymphoid specific helicase
           variant8 protein.
          Length = 884

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 663 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 720

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 721 RAGGLGINLTAADTV 735



 Score = 31.9 bits (69), Expect = 2.7
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
           A N+  +TGTP+ N   +++S++NFL    F+D
Sbjct: 375 ADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDD 407


>AB102721-1|BAD10849.1|  740|Homo sapiens lymphoid specific helicase
           variant6 protein.
          Length = 740

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 519 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 576

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 577 RAGGLGINLTAADTV 591


>AB102719-1|BAD10847.1|  708|Homo sapiens lymphoid specific helicase
           variant4 protein.
          Length = 708

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 487 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 544

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 545 RAGGLGINLTAADTV 559


>AB074174-1|BAE45737.1|  372|Homo sapiens putative protein product
           of Nbla10143 protein.
          Length = 372

 Score = 33.5 bits (73), Expect = 0.89
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L SQ    L I  ++   ++       G +   +R     +FN   D +  I L+S 
Sbjct: 151 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT--DPEVFIFLVST 208

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 209 RAGGLGINLTAADTV 223


>BC112201-1|AAI12202.1| 1849|Homo sapiens BTAF1 RNA polymerase II,
            B-TFIID transcription factor-associated, 170kDa protein.
          Length = 1849

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 1646 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 1703

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL G +T+
Sbjct: 1704 LTTHVGGLGLNLTGADTV 1721



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284  KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
            + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 1539 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 1586


>BC029930-1|AAH29930.1|  680|Homo sapiens BTAF1 protein protein.
          Length = 680

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
           +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 477 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 534

Query: 715 LSIKCGGVGLNLIGGNTL 768
           L+   GG+GLNL G +T+
Sbjct: 535 LTTHVGGLGLNLTGADTV 552



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284 KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 370 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 417


>AL365398-1|CAI14103.1| 1849|Homo sapiens BTAF1 RNA polymerase II,
            B-TFIID transcription factor-associated, 170kDa (Mot1
            protein.
          Length = 1849

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 1646 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 1703

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL G +T+
Sbjct: 1704 LTTHVGGLGLNLTGADTV 1721



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284  KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
            + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 1539 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 1586


>AL359198-2|CAH73478.1| 1849|Homo sapiens BTAF1 RNA polymerase II,
            B-TFIID transcription factor-associated, 170kDa (Mot1
            protein.
          Length = 1849

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 1646 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 1703

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL G +T+
Sbjct: 1704 LTTHVGGLGLNLTGADTV 1721



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284  KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
            + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 1539 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 1586


>AJ001017-1|CAA04475.1| 1849|Homo sapiens TBP associated factor
            protein.
          Length = 1849

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 1646 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 1703

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL G +T+
Sbjct: 1704 LTTHVGGLGLNLTGADTV 1721



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284  KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
            + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 1539 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 1586


>AF038362-1|AAC04573.1| 1849|Homo sapiens TBP-associated factor 172
            protein.
          Length = 1849

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 1646 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 1703

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL G +T+
Sbjct: 1704 LTTHVGGLGLNLTGADTV 1721



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284  KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
            + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 1539 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 1586


>AB208843-1|BAD92080.1|  699|Homo sapiens BTAF1 RNA polymerase II,
           B-TFIID transcription factor-associated, 170kDa varian
           protein.
          Length = 699

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
           +I++  Q    L I E+   + ++ ++ Y    G +    R    + FNN  D    +LL
Sbjct: 496 RILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNN--DPSIDVLL 553

Query: 715 LSIKCGGVGLNLIGGNTL 768
           L+   GG+GLNL G +T+
Sbjct: 554 LTTHVGGLGLNLTGADTV 571



 Score = 31.5 bits (68), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +2

Query: 284 KLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           + KC+ +E    A  + E+E    +L+   HV   +  LR++C HP L +
Sbjct: 389 RAKCDVDETVSSATLSEETEKP--KLKATGHVFQALQYLRKLCNHPALVL 436


>AB007913-1|BAA32289.1|  978|Homo sapiens KIAA0444 protein protein.
          Length = 978

 Score = 32.7 bits (71), Expect = 1.6
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ  + L + E+F + +        G +    R  A   FN A   Q  
Sbjct: 60  LRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFN-APGAQQF 118

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 119 CFLLSTRAGGLGINLATADTV 139


>Z84487-2|CAI42674.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>Z84487-1|CAI42675.1| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2041 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2092


>U97103-1|AAC51657.1| 2375|Homo sapiens X-linked nuclear protein
            protein.
          Length = 2375

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1962 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2013


>U75653-1|AAC51655.1| 2492|Homo sapiens zinc finger helicase protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>U72938-1|AAB49971.2| 2454|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2454

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2041 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2092


>U72937-1|AAB49970.2| 2492|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>U72936-1|AAB49969.1| 2288|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2288

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1875 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 1926


>U72935-3|AAB40700.1| 2288|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2288

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1875 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 1926


>U72935-2|AAB40699.1| 2337|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2337

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1924 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 1975


>U72935-1|AAB40698.1| 2375|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2375

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1962 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2013


>U09820-1|AAC50069.1| 1641|Homo sapiens helicase II protein.
          Length = 1641

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 1221 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 1272


>L34363-1|AAA20872.1| 1298|Homo sapiens X-linked nuclear protein
            protein.
          Length = 1298

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 940  RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 991


>EF467914-1|ABO43036.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>AL121874-2|CAI40710.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>AL121874-1|CAB90351.2| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2041 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2092


>AL109753-2|CAI43115.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>AL109753-1|CAI43116.1| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2041 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2092


>AK027490-1|BAB55150.1|  702|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14584 fis, clone NT2RM4001592. ).
          Length = 702

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           + A NR  +TGTP+ N   ++ S++NF+    F+
Sbjct: 647 INANNRLLLTGTPVQNNLLELMSLLNFVMPHMFS 680


>AB102641-1|BAC81110.1| 2492|Homo sapiens ATRX protein.
          Length = 2492

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 607  KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +NI      G    + R      FN+  + + R+ ++S K G +G+NL+  N
Sbjct: 2079 RNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAAN 2130


>EU069463-1|ABU25227.1| 1250|Homo sapiens Plk1-interacting
           checkpoint helicase protein.
          Length = 1250

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINF 86
           A+ A+NR  +TGTPI N   +++S+ +F
Sbjct: 246 AIPASNRLLLTGTPIQNNLQELWSLFDF 273


>BC111486-1|AAI11487.1| 1250|Homo sapiens excision repair
           cross-complementing rodent repair deficiency,
           complementation g protein.
          Length = 1250

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINF 86
           A+ A+NR  +TGTPI N   +++S+ +F
Sbjct: 246 AIPASNRLLLTGTPIQNNLQELWSLFDF 273


>AK074719-1|BAC11160.1| 1106|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90238 fis, clone NT2RM2000632, weakly similar to
           EXCISION REPAIR PROTEIN ERCC-6. ).
          Length = 1106

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINF 86
           A+ A+NR  +TGTPI N   +++S+ +F
Sbjct: 102 AIPASNRLLLTGTPIQNNLQELWSLFDF 129


>X97668-1|CAA66258.1|  815|Homo sapiens XLRP3 protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 6.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 123 KMLNKNNDSTNRIKSIIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKKRCTI 284
           K++  NN+    IKSI  +I+LK D  +   N + ++       N  ++ K CTI
Sbjct: 760 KIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTI 814


>U57629-1|AAC50481.1|  815|Homo sapiens retinitis pigmentosa GTPase
           regulator protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 6.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 123 KMLNKNNDSTNRIKSIIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKKRCTI 284
           K++  NN+    IKSI  +I+LK D  +   N + ++       N  ++ K CTI
Sbjct: 760 KIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTI 814


>AL606748-2|CAI95407.1|  815|Homo sapiens retinitis pigmentosa
           GTPase regulator protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 6.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 123 KMLNKNNDSTNRIKSIIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKKRCTI 284
           K++  NN+    IKSI  +I+LK D  +   N + ++       N  ++ K CTI
Sbjct: 760 KIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTI 814


>AK223491-1|BAD97211.1|  815|Homo sapiens retinitis pigmentosa
           GTPase regulator variant protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 6.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 123 KMLNKNNDSTNRIKSIIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKKRCTI 284
           K++  NN+    IKSI  +I+LK D  +   N + ++       N  ++ K CTI
Sbjct: 760 KIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTI 814


>AJ318463-1|CAC86116.1|  815|Homo sapiens retinitis pigmentosa
           GTPase regulator protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 6.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 123 KMLNKNNDSTNRIKSIIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKKRCTI 284
           K++  NN+    IKSI  +I+LK D  +   N + ++       N  ++ K CTI
Sbjct: 760 KIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTI 814


>BC024298-1|AAH24298.1| 1359|Homo sapiens RAD54-like 2 (S.
           cerevisiae) protein.
          Length = 1359

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 607 KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           +NI+     G     +R      FN+ ++    + LLS + G +G+NLIG N
Sbjct: 670 RNISYFRLDGSTPAFERERLINQFNDPSNLTTWLFLLSTRAGCLGVNLIGAN 721


>BC001474-1|AAH01474.2| 1159|Homo sapiens RAD54L2 protein protein.
          Length = 1159

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 607 KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           +NI+     G     +R      FN+ ++    + LLS + G +G+NLIG N
Sbjct: 470 RNISYFRLDGSTPAFERERLINQFNDPSNLTTWLFLLSTRAGCLGVNLIGAN 521


>AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein KIF21B
            variant protein.
          Length = 1670

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +1

Query: 550  ILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-NAADTQHRILLLSIK 726
            ++ S    Y+K+++     K I TL  +GQ+   D   A +T    +A  +H+I  +++ 
Sbjct: 1364 LVFSVSTSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALS 1423

Query: 727  CGGVGLNLIGGNTL*CWSL 783
              G  L    GN +  W L
Sbjct: 1424 PSGTMLYAASGNAVRIWEL 1442


>AB018352-1|BAA34529.2| 1385|Homo sapiens KIAA0809 protein protein.
          Length = 1385

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 607 KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           +NI+     G     +R      FN+ ++    + LLS + G +G+NLIG N
Sbjct: 696 RNISYFRLDGSTPAFERERLINQFNDPSNLTTWLFLLSTRAGCLGVNLIGAN 747


>AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein.
          Length = 1628

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +1

Query: 550  ILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-NAADTQHRILLLSIK 726
            ++ S    Y+K+++     K I TL  +GQ+   D   A +T    +A  +H+I  +++ 
Sbjct: 1353 LVFSVSTSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALS 1412

Query: 727  CGGVGLNLIGGNTL*CWSL 783
              G  L    GN +  W L
Sbjct: 1413 PSGTMLYAASGNAVRIWEL 1431


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,360,794
Number of Sequences: 237096
Number of extensions: 2223956
Number of successful extensions: 5308
Number of sequences better than 10.0: 167
Number of HSP's better than 10.0 without gapping: 4882
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5279
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9646050614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -