SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U85962-1|AAC51331.2| 2442|Homo sapiens CREB-binding protein prot...    36   0.15 
U47741-1|AAC51770.1| 2442|Homo sapiens CREB-binding protein prot...    36   0.15 
AB210043-1|BAE06125.1| 2472|Homo sapiens CREBBP variant protein ...    36   0.15 
L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein.           35   0.35 
AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein.         35   0.35 
BC052955-1|AAH52955.1|  505|Homo sapiens Wiskott-Aldrich syndrom...    33   1.1  
AM295156-1|CAL26602.1|  505|Homo sapiens WASL protein protein.         33   1.1  
AC006333-1|AAQ96857.1|  505|Homo sapiens unknown protein.              33   1.1  
D88460-1|BAA20128.1|  505|Homo sapiens N-WASP protein.                 32   1.8  
AM156947-1|CAJ42307.1| 1221|Homo sapiens centrosome and spindle ...    31   4.3  
AJ583433-1|CAE47426.1|  876|Homo sapiens centrosome spindle pole...    31   4.3  
AB067019-1|BAC02057.1|  121|Homo sapiens immunoglobulin heavy ch...    31   4.3  
Y08267-1|CAA69593.1|  238|Homo sapiens AAD10 protein.                  31   5.6  
AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein.                  31   5.6  
AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein.                  31   5.6  
AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or mix...    31   5.6  
U80756-1|AAB91448.1|  169|Homo sapiens polyglutamine rich protei...    30   7.4  
BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of activ...    30   7.4  
BC131509-1|AAI31510.1| 1548|Homo sapiens NFAT5 protein protein.        30   7.4  
AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein.     30   7.4  

>U85962-1|AAC51331.2| 2442|Homo sapiens CREB-binding protein protein.
          Length = 2442

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +1

Query: 37   TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
            TPP P   P+ P+T + ++ QT    PG VP  T+     T ++ +   V   P    + 
Sbjct: 878  TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 936

Query: 217  PTLDAGES 240
            P++   +S
Sbjct: 937  PSVATPQS 944


>U47741-1|AAC51770.1| 2442|Homo sapiens CREB-binding protein protein.
          Length = 2442

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +1

Query: 37   TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
            TPP P   P+ P+T + ++ QT    PG VP  T+     T ++ +   V   P    + 
Sbjct: 878  TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 936

Query: 217  PTLDAGES 240
            P++   +S
Sbjct: 937  PSVATPQS 944


>AB210043-1|BAE06125.1| 2472|Homo sapiens CREBBP variant protein
            protein.
          Length = 2472

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +1

Query: 37   TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
            TPP P   P+ P+T + ++ QT    PG VP  T+     T ++ +   V   P    + 
Sbjct: 908  TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 966

Query: 217  PTLDAGES 240
            P++   +S
Sbjct: 967  PSVATPQS 974


>L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein.
          Length = 1898

 Score = 34.7 bits (76), Expect = 0.35
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 48  AAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDAR 227
           A E  L S  GH  +    +++ R R   + R++   E QQQ +   DR  Q+E+  + R
Sbjct: 188 AEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWR 247

Query: 228 RRRIYL 245
           +R   L
Sbjct: 248 KRETVL 253


>AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein.
          Length = 1943

 Score = 34.7 bits (76), Expect = 0.35
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 48  AAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDAR 227
           A E  L S  GH  +    +++ R R   + R++   E QQQ +   DR  Q+E+  + R
Sbjct: 188 AEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWR 247

Query: 228 RRRIYL 245
           +R   L
Sbjct: 248 KRETVL 253


>BC052955-1|AAH52955.1|  505|Homo sapiens Wiskott-Aldrich
           syndrome-like protein.
          Length = 505

 Score = 33.1 bits (72), Expect = 1.1
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = -1

Query: 647 TSPIPPPCTGRPS*VVCPPRPKRLYP 570
           T+  PPP   RPS  V PP P R+YP
Sbjct: 319 TAAPPPPPPSRPSVAVPPPPPNRMYP 344


>AM295156-1|CAL26602.1|  505|Homo sapiens WASL protein protein.
          Length = 505

 Score = 33.1 bits (72), Expect = 1.1
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = -1

Query: 647 TSPIPPPCTGRPS*VVCPPRPKRLYP 570
           T+  PPP   RPS  V PP P R+YP
Sbjct: 319 TAAPPPPPPSRPSVAVPPPPPNRMYP 344


>AC006333-1|AAQ96857.1|  505|Homo sapiens unknown protein.
          Length = 505

 Score = 33.1 bits (72), Expect = 1.1
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = -1

Query: 647 TSPIPPPCTGRPS*VVCPPRPKRLYP 570
           T+  PPP   RPS  V PP P R+YP
Sbjct: 319 TAAPPPPPPSRPSVAVPPPPPNRMYP 344


>D88460-1|BAA20128.1|  505|Homo sapiens N-WASP protein.
          Length = 505

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = -1

Query: 647 TSPIPPPCTGRPS*VVCPPRPKRLYP 570
           T+  PPP   RPS  V PP P R+YP
Sbjct: 319 TAAPPPPPPSRPSVEVPPPPPNRMYP 344


>AM156947-1|CAJ42307.1| 1221|Homo sapiens centrosome and spindle
           pole associated protein 1 protein.
          Length = 1221

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 12/51 (23%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQ--QEQRTDARRRR 236
           +R   +QRAR++  Y+  Q+   E +++ +L ++  ++  +E++ +A R++
Sbjct: 765 ERRLAEQRARIQQEYEEEQEKKREKEEEQRLKNEEHIRLAEERQKEAERKK 815


>AJ583433-1|CAE47426.1|  876|Homo sapiens centrosome spindle pole
           associated protein protein.
          Length = 876

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 12/51 (23%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQ--QEQRTDARRRR 236
           +R   +QRAR++  Y+  Q+   E +++ +L ++  ++  +E++ +A R++
Sbjct: 420 ERRLAEQRARIQQEYEEEQEKKREKEEEQRLKNEEHIRLAEERQKEAERKK 470


>AB067019-1|BAC02057.1|  121|Homo sapiens immunoglobulin heavy chain
           VHDJ region protein.
          Length = 121

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +2

Query: 470 RVPAERFEYISGIFVLNSLPAYAQKFYNGGADMLGKDALAEAGKQLS 610
           + P +  E++ GI  +  +P YAQKF  G   +   D+   A  +LS
Sbjct: 39  QAPGQGLEWMGGIIPIRGIPTYAQKF-QGRLTITADDSTTTAYMELS 84


>Y08267-1|CAA69593.1|  238|Homo sapiens AAD10 protein.
          Length = 238

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 90  QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           Q   LQ Q+ R++ A   +QQ   + QQQH LG     QQ+Q+
Sbjct: 28  QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 70


>AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein.
          Length = 4957

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 90   QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            Q   LQ Q+ R++ A   +QQ   + QQQH LG     QQ+Q+
Sbjct: 3137 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 3179


>AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein.
          Length = 5262

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 90   QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            Q   LQ Q+ R++ A   +QQ   + QQQH LG     QQ+Q+
Sbjct: 3442 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 3484


>AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia 2 variant protein.
          Length = 2704

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 90   QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            Q   LQ Q+ R++ A   +QQ   + QQQH LG     QQ+Q+
Sbjct: 884  QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 926


>U80756-1|AAB91448.1|  169|Homo sapiens polyglutamine rich protein
           protein.
          Length = 169

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = +3

Query: 90  QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           Q   LQ Q+ R++ A   +QQ   + QQQH LG     QQ+Q
Sbjct: 44  QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQ 85


>BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of
           activated T-cells 5, tonicity-responsive protein.
          Length = 1531

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 210
           Y+  P  L+ P +  T++ + +QT     G  PP        ++ S+S+   A + +  S
Sbjct: 28  YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 87

Query: 211 KEPTL 225
             PT+
Sbjct: 88  SSPTI 92


>BC131509-1|AAI31510.1| 1548|Homo sapiens NFAT5 protein protein.
          Length = 1548

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 210
           Y+  P  L+ P +  T++ + +QT     G  PP        ++ S+S+   A + +  S
Sbjct: 46  YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 105

Query: 211 KEPTL 225
             PT+
Sbjct: 106 SSPTI 110


>AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein.
          Length = 1608

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 210
           Y+  P  L+ P +  T++ + +QT     G  PP        ++ S+S+   A + +  S
Sbjct: 105 YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 164

Query: 211 KEPTL 225
             PT+
Sbjct: 165 SSPTI 169


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,668,980
Number of Sequences: 237096
Number of extensions: 2452429
Number of successful extensions: 13622
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 11701
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12990
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8679165170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -