SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein.          43   9e-04

>AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein.
          Length = 1183

 Score = 43.2 bits (97), Expect = 9e-04
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +ED G  ++  K     P+V +LG  I        SER Q +   P P++ + +R+F+G 
Sbjct: 356 LEDCGYKVSKKKAQICRPQVRYLGFTIRQGERSLGSERKQVICTLPEPKSRKQVRKFLGA 415

Query: 433 VNYYRRFLRNAAKLQAPL 486
             + R ++ N A L  PL
Sbjct: 416 AGFCRLWIPNFAVLAKPL 433


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,090,816
Number of Sequences: 237096
Number of extensions: 1811697
Number of successful extensions: 3141
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3033
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3138
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -