SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC064404-1|AAH64404.1|  719|Homo sapiens nucleolar protein 11 pr...    32   1.7  
BC001726-1|AAH01726.2|  408|Homo sapiens NOL11 protein protein.        32   1.7  
AY598333-1|AAT06744.1|  719|Homo sapiens L14 protein.                  32   1.7  
AL110271-1|CAB53709.1|  314|Homo sapiens hypothetical protein pr...    32   1.7  
AK023702-1|BAB14647.1|  719|Homo sapiens protein ( Homo sapiens ...    32   1.7  

>BC064404-1|AAH64404.1|  719|Homo sapiens nucleolar protein 11
           protein.
          Length = 719

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142
           +P F T+ G   V     RC     FYPR CL +L   H+L+   CP
Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471


>BC001726-1|AAH01726.2|  408|Homo sapiens NOL11 protein protein.
          Length = 408

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142
           +P F T+ G   V     RC     FYPR CL +L   H+L+   CP
Sbjct: 115 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 160


>AY598333-1|AAT06744.1|  719|Homo sapiens L14 protein.
          Length = 719

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142
           +P F T+ G   V     RC     FYPR CL +L   H+L+   CP
Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471


>AL110271-1|CAB53709.1|  314|Homo sapiens hypothetical protein
           protein.
          Length = 314

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142
           +P F T+ G   V     RC     FYPR CL +L   H+L+   CP
Sbjct: 21  TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 66


>AK023702-1|BAB14647.1|  719|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13640 fis, clone PLACE1011221. ).
          Length = 719

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142
           +P F T+ G   V     RC     FYPR CL +L   H+L+   CP
Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,111,292
Number of Sequences: 237096
Number of extensions: 1942364
Number of successful extensions: 3879
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 3699
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3879
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8119219030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -