SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z95113-1|CAI17901.1|  836|Homo sapiens protein ( Human DNA seque...    33   1.4  
CR456397-1|CAG30283.1|  836|Homo sapiens bK175E3.6 protein.            33   1.4  
BC021570-1|AAH21570.1|  653|Homo sapiens ZNRF3 protein protein.        33   1.4  
AY332222-1|AAP93638.1|  592|Homo sapiens impedes mitogenic signa...    33   1.4  
AL021393-4|CAI17992.1|  836|Homo sapiens protein ( Human DNA seq...    33   1.4  
AF035620-1|AAC24200.1|  600|Homo sapiens BRCA1-associated protei...    33   1.4  
AB208878-1|BAD92115.1|  632|Homo sapiens BRCA1 associated protei...    33   1.4  
AB051436-1|BAB33319.1|  891|Homo sapiens KIAA1133 protein protein.     33   1.4  

>Z95113-1|CAI17901.1|  836|Homo sapiens protein ( Human DNA sequence
           from clone CTA-175E3 on chromosome 22q12.1. ).
          Length = 836

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 190 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 234


>CR456397-1|CAG30283.1|  836|Homo sapiens bK175E3.6 protein.
          Length = 836

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 190 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 234


>BC021570-1|AAH21570.1|  653|Homo sapiens ZNRF3 protein protein.
          Length = 653

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 7   TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 51


>AY332222-1|AAP93638.1|  592|Homo sapiens impedes mitogenic signal
           propagation protein.
          Length = 592

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 84  ECQICLEKIDDN-GGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CLE++D++  GI+    T + N    FH QC+QRW
Sbjct: 263 KCTVCLERMDESVNGIL----TTLCN--HSFHSQCLQRW 295


>AL021393-4|CAI17992.1|  836|Homo sapiens protein ( Human DNA
           sequence from clone CTA-747E2 on chromosome 22q12.1. ).
          Length = 836

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 190 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 234


>AF035620-1|AAC24200.1|  600|Homo sapiens BRCA1-associated protein 2
           protein.
          Length = 600

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 84  ECQICLEKIDDN-GGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CLE++D++  GI+    T + N    FH QC+QRW
Sbjct: 263 KCTVCLERMDESVNGIL----TTLCN--HSFHSQCLQRW 295


>AB208878-1|BAD92115.1|  632|Homo sapiens BRCA1 associated protein
           variant protein.
          Length = 632

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 84  ECQICLEKIDDN-GGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CLE++D++  GI+    T + N    FH QC+QRW
Sbjct: 303 KCTVCLERMDESVNGIL----TTLCN--HSFHSQCLQRW 335


>AB051436-1|BAB33319.1|  891|Homo sapiens KIAA1133 protein protein.
          Length = 891

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 245 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 289


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,763,053
Number of Sequences: 237096
Number of extensions: 1900279
Number of successful extensions: 4635
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 4415
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4630
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -