SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) bo...   159   8e-39
U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72 prot...   159   8e-39
CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.               159   8e-39
BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   159   8e-39
AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17...   159   8e-39
X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for ...   154   2e-37
X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for ...   154   2e-37
BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein pr...   154   2e-37
BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...   154   2e-37
BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   154   2e-37
AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.    154   2e-37
AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein DK...   154   2e-37
BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   104   3e-22
BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.       104   3e-22
BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.       104   3e-22
AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related pr...   104   3e-22
AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related pr...   104   3e-22
BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   103   6e-22
BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   103   6e-22
AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE p...   103   6e-22
BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...   103   8e-22
AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.    103   8e-22
U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2 p...    99   7e-21
BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.        99   7e-21
BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    99   7e-21
AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    99   7e-21
AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase D...    99   7e-21
AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform pro...    99   7e-21
AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform pro...    99   7e-21
AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform pro...    99   7e-21
AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform pro...    99   7e-21
AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    99   7e-21
AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.              98   2e-20
BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    97   4e-20
AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.         97   4e-20
AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.     97   4e-20
BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein pr...    85   3e-16
BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    85   3e-16
AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstra...    85   3e-16
AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens ...    85   3e-16
AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstra...    85   3e-16
AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens ...    82   2e-15
BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    79   1e-14
BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.         79   1e-14
AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase p...    79   1e-14
AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein pr...    79   1e-14
AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.         79   1e-14
BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    77   6e-14
AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein...    77   6e-14
BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    67   6e-11
BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.        67   6e-11
AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein pr...    67   6e-11
AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens ...    67   6e-11
AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.     67   6e-11
AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.      67   6e-11
AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    64   4e-10
BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    63   8e-10
AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    63   8e-10
AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2 v...    63   8e-10
AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2 p...    63   8e-10
BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    63   1e-09
BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.        63   1e-09
AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    63   1e-09
AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    63   1e-09
BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   3e-09
BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   3e-09
BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.        61   3e-09
BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.        61   3e-09
BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.        61   3e-09
AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like prote...    61   3e-09
AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   3e-09
AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   3e-09
AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens ...    61   3e-09
AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like prote...    61   3e-09
D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.                    60   5e-09
BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.         60   5e-09
BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.        60   9e-09
AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   9e-09
AL354735-1|CAI16564.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   9e-09
AL160165-3|CAH70532.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   9e-09
AL160165-2|CAH70531.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   9e-09
AL160165-1|CAH70530.1|  585|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   9e-09
AK027484-1|BAB55146.1|  585|Homo sapiens protein ( Homo sapiens ...    60   9e-09
AK027002-1|BAB15620.1|  674|Homo sapiens protein ( Homo sapiens ...    60   9e-09
AF427339-1|AAL26549.1|  851|Homo sapiens DEAD/DEXH helicase DDX3...    60   9e-09
AF335569-1|AAQ14890.1|  758|Homo sapiens helicain C protein.           60   9e-09
AF335568-1|AAQ14889.1|  851|Homo sapiens helicain B protein.           60   9e-09
AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.              60   9e-09
BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.        59   1e-08
U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.             58   2e-08
U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box ...    58   2e-08
BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.        58   2e-08
BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   2e-08
AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.         58   2e-08
AB001343-1|BAA20386.1|  111|Homo sapiens DDX10-NUP98 fusion prot...    58   2e-08
D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.               58   4e-08
CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.                58   4e-08
BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation ...    58   4e-08
BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation ...    58   4e-08
BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation ...    58   4e-08
AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu prot...    57   7e-08
X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.           56   1e-07
CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.                56   1e-07
BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    56   1e-07
BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.        56   1e-07
BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    56   1e-07
BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    56   1e-07
AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase D...    56   1e-07
AK091227-1|BAC03616.1|  408|Homo sapiens protein ( Homo sapiens ...    56   1e-07
AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens ...    56   1e-07
AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helic...    56   1e-07
AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.              56   1e-07
AK023695-1|BAB14644.1|  556|Homo sapiens protein ( Homo sapiens ...    55   2e-07
X79538-1|CAA56074.1|  411|Homo sapiens translation initiation fa...    54   4e-07
D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation fac...    54   4e-07
BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation ...    54   4e-07
BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation ...    54   4e-07
BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation ...    54   4e-07
BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation ...    54   4e-07
BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for IM...    54   4e-07
AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant pr...    54   4e-07
BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    54   6e-07
AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    54   6e-07
AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.             54   6e-07
AB000267-1|BAA20379.1|  124|Homo sapiens NUP98-DDX10 fusion prot...    54   6e-07
BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation ...    53   8e-07
BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation ...    53   8e-07
BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    53   8e-07
BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation ...    53   8e-07
BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation ...    53   8e-07
BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation ...    53   8e-07
AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens ...    53   8e-07
AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens ...    53   8e-07
AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.     53   8e-07
AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens ...    53   1e-06
D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation fac...    52   2e-06
D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.           51   3e-06
BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   8e-06
AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens ...    50   8e-06
AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens ...    50   8e-06
AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helic...    50   8e-06
EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47...    46   9e-05
AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.     46   9e-05
Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEA...    46   1e-04
BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated transc...    46   1e-04
BX248516-5|CAM25876.1|  245|Homo sapiens HLA-B associated transc...    46   1e-04
BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated transc...    46   1e-04
BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent...    46   1e-04
AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated trans...    46   1e-04
AL662847-22|CAO72085.1|  245|Homo sapiens HLA-B associated trans...    46   1e-04
AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated trans...    46   1e-04
AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated trans...    46   1e-04
AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated transc...    46   1e-04
AL662801-5|CAM25576.1|  245|Homo sapiens HLA-B associated transc...    46   1e-04
AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated transc...    46   1e-04
AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.                 46   1e-04
AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.         46   1e-04
AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.        46   2e-04
AK056044-1|BAB71082.1|  189|Homo sapiens protein ( Homo sapiens ...    45   3e-04
BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated transc...    44   4e-04
BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   4e-04
BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   4e-04
BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   4e-04
AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   4e-04
AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase G...    44   4e-04
AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP...    44   4e-04
AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.     44   4e-04
AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated transc...    44   4e-04
X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protei...    43   0.001
EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1 ...    43   0.001
EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1 ...    43   0.001
BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.        43   0.001
AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens ...    42   0.002
U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase prot...    42   0.002
BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.        42   0.002
BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.        42   0.002
BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens ...    42   0.002
AJ010931-1|CAA09408.1|  111|Homo sapiens p68 RNA helicase protein.     42   0.002
AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helic...    42   0.002
AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated transc...    41   0.004
BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated transc...    41   0.004
AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated trans...    41   0.004
AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated trans...    41   0.004
AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated transc...    41   0.004
AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated transc...    41   0.004
AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helic...    40   0.008
AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helic...    40   0.008
CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.                40   0.011
BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.011
AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase ...    40   0.011
AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase p...    40   0.011
BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.025
AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens ...    38   0.025
AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens ...    38   0.025
AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens ...    38   0.025
AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helic...    38   0.025
AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helic...    38   0.025
AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.033
AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens ...    37   0.076
BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated transc...    36   0.10 
AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated trans...    36   0.10 
AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated transc...    36   0.10 
BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.23 
BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.23 
BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.23 
AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated ...    35   0.23 
AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.23 
AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated ...    35   0.23 
BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.         34   0.54 
BC018637-1|AAH18637.2|  423|Homo sapiens DDX50 protein protein.        30   8.8  

>Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 650

 Score =  159 bits (386), Expect = 8e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 224 GRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 283

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DY QIN+G+L+LSA
Sbjct: 284 VRQLAEDFLRDYTQINVGNLELSA 307



 Score =  136 bits (329), Expect = 7e-32
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVA D+G  S +++TC
Sbjct: 139 GSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTC 198

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 199 IYGGAPKGPQIRDLERGVEICIAT 222



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 29/46 (63%), Positives = 36/46 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C E EK++KL  L++EI   +E   KTIIFVETKR+
Sbjct: 308 NHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVETKRR 351


>U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72
           protein.
          Length = 650

 Score =  159 bits (386), Expect = 8e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 224 GRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 283

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DY QIN+G+L+LSA
Sbjct: 284 VRQLAEDFLRDYTQINVGNLELSA 307



 Score =  136 bits (329), Expect = 7e-32
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVA D+G  S +++TC
Sbjct: 139 GSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTC 198

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 199 IYGGAPKGPQIRDLERGVEICIAT 222



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 29/46 (63%), Positives = 36/46 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C E EK++KL  L++EI   +E   KTIIFVETKR+
Sbjct: 308 NHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVETKRR 351


>CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.
          Length = 652

 Score =  159 bits (386), Expect = 8e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 224 GRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 283

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DY QIN+G+L+LSA
Sbjct: 284 VRQLAEDFLRDYTQINVGNLELSA 307



 Score =  136 bits (329), Expect = 7e-32
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVA D+G  S +++TC
Sbjct: 139 GSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTC 198

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 199 IYGGAPKGPQIRDLERGVEICIAT 222



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 29/46 (63%), Positives = 36/46 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C E EK++KL  L++EI   +E   KTIIFVETKR+
Sbjct: 308 NHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVETKRR 351


>BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 729

 Score =  159 bits (386), Expect = 8e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 303 GRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 362

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DY QIN+G+L+LSA
Sbjct: 363 VRQLAEDFLRDYTQINVGNLELSA 386



 Score =  136 bits (329), Expect = 7e-32
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVA D+G  S +++TC
Sbjct: 218 GSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTC 277

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 278 IYGGAPKGPQIRDLERGVEICIAT 301



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 29/46 (63%), Positives = 36/46 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C E EK++KL  L++EI   +E   KTIIFVETKR+
Sbjct: 387 NHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVETKRR 430


>AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17
           isoform p82 variant protein.
          Length = 737

 Score =  159 bits (386), Expect = 8e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 305 GRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 364

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DY QIN+G+L+LSA
Sbjct: 365 VRQLAEDFLRDYTQINVGNLELSA 388



 Score =  136 bits (329), Expect = 7e-32
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVA D+G  S +++TC
Sbjct: 220 GSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTC 279

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 280 IYGGAPKGPQIRDLERGVEICIAT 303



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 29/46 (63%), Positives = 36/46 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C E EK++KL  L++EI   +E   KTIIFVETKR+
Sbjct: 389 NHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVETKRR 432


>X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for p68
           protein. ).
          Length = 614

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for
           nuclear p68 protein. ).
          Length = 614

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein
           protein.
          Length = 406

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase,
           68kDa) protein.
          Length = 614

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 5 protein.
          Length = 614

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.
          Length = 614

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 226 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 286 VRQLAEDFLKDYIHINIGALELSA 309



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 141 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 200

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 201 IYGGAPKGPQIRDLERGVEICIAT 224



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 310 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 353


>AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein
           DKFZp686J01190 variant protein.
          Length = 457

 Score =  154 bits (374), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE G TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 277 GRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 336

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAED+L DYI INIG+L+LSA
Sbjct: 337 VRQLAEDFLKDYIHINIGALELSA 360



 Score =  130 bits (315), Expect = 3e-30
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPAIVHIN+QP + RGDGPI LVLAPTRELAQQ+QQVAA++     +++TC
Sbjct: 192 GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTC 251

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERGVEI IAT
Sbjct: 252 IYGGAPKGPQIRDLERGVEICIAT 275



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NHNILQIVD+C + EK+ KL  L++EI   +E   KTI+FVETKR+
Sbjct: 361 NHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVETKRR 404


>BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 42 protein.
          Length = 938

 Score =  104 bits (249), Expect = 3e-22
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 373 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 432

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 433 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 464



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 300 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 359

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 360 VYGGGSMWEQAKALQEGAEIVVCT 383


>BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.
          Length = 919

 Score =  104 bits (249), Expect = 3e-22
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 354 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 413

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 414 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 445



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 281 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 340

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 341 VYGGGSMWEQAKALQEGAEIVVCT 364


>BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.
          Length = 819

 Score =  104 bits (249), Expect = 3e-22
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 254 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 313

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 314 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 345



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 181 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 240

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 241 VYGGGSMWEQAKALQEGAEIVVCT 264


>AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related
           protein protein.
          Length = 709

 Score =  104 bits (249), Expect = 3e-22
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 254 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 313

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 314 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 345



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 181 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 240

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 241 VYGGGSMWEQAKALQEGAEIVVCT 264


>AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related
           protein protein.
          Length = 938

 Score =  104 bits (249), Expect = 3e-22
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 373 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 432

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 433 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 464



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 300 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 359

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 360 VYGGGSMWEQAKALQEGAEIVVCT 383


>BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score =  103 bits (247), Expect = 6e-22
 Identities = 49/87 (56%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D     + NL+  TYLV+DEAD+MLDM FEPQIRKI+  +RPDRQT+M SATWP  
Sbjct: 354 GRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDT 413

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V++LA  YL D + + +G+L L A+ T
Sbjct: 414 VRQLALSYLKDPMIVYVGNLNLVAVNT 440



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL+Y++P  +H+++QP  R + +GP  LVL PTRELA  ++   + + +   +++ 
Sbjct: 269 GTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKG-LKSI 327

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C++GG  +  Q  D+ +GV+I+IAT
Sbjct: 328 CIYGGRNRNGQIEDISKGVDIIIAT 352


>BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score =  103 bits (247), Expect = 6e-22
 Identities = 49/87 (56%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D     + NL+  TYLV+DEAD+MLDM FEPQIRKI+  +RPDRQT+M SATWP  
Sbjct: 354 GRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDT 413

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V++LA  YL D + + +G+L L A+ T
Sbjct: 414 VRQLALSYLKDPMIVYVGNLNLVAVNT 440



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL+Y++P  +H+++QP  R + +GP  LVL PTRELA  ++   + + +   +++ 
Sbjct: 269 GTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKG-LKSI 327

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C++GG  +  Q  D+ +GV+I+IAT
Sbjct: 328 CIYGGRNRNGQIEDISKGVDIIIAT 352


>AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE
           protein.
          Length = 630

 Score =  103 bits (247), Expect = 6e-22
 Identities = 49/87 (56%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D     + NL+  TYLV+DEAD+MLDM FEPQIRKI+  +RPDRQT+M SATWP  
Sbjct: 354 GRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDT 413

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V++LA  YL D + + +G+L L A+ T
Sbjct: 414 VRQLALSYLKDPMIVYVGNLNLVAVNT 440



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL+Y++P  +H+++QP  R + +GP  LVL PTRELA  ++   + + +   +++ 
Sbjct: 269 GTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKG-LKSI 327

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C++GG  +  Q  D+ +GV+I+IAT
Sbjct: 328 CIYGGRNRNGQIEDISKGVDIIIAT 352


>BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 43 protein.
          Length = 648

 Score =  103 bits (246), Expect = 8e-22
 Identities = 48/87 (55%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D       NL+  TYLVLDEAD+MLDMGFEPQI KI+  +RPDRQT+M SATWP  
Sbjct: 374 GRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHS 433

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V +LA+ YL + + + +G+L L A+++
Sbjct: 434 VHRLAQSYLKEPMIVYVGTLDLVAVSS 460



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL Y++P  +H+  QP ++ + + P  LVL PTRELA Q++     + +   +R+ 
Sbjct: 289 GTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKG-LRSV 347

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG  + EQ  +L++GV+I+IAT
Sbjct: 348 CVYGGGNRDEQIEELKKGVDIIIAT 372


>AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.
          Length = 648

 Score =  103 bits (246), Expect = 8e-22
 Identities = 48/87 (55%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D       NL+  TYLVLDEAD+MLDMGFEPQI KI+  +RPDRQT+M SATWP  
Sbjct: 374 GRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHS 433

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V +LA+ YL + + + +G+L L A+++
Sbjct: 434 VHRLAQSYLKEPMIVYVGTLDLVAVSS 460



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL Y++P  +H+  QP ++ + + P  LVL PTRELA Q++     + +   +R+ 
Sbjct: 289 GTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKG-LRSV 347

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG  + EQ  +L++GV+I+IAT
Sbjct: 348 CVYGGGNRDEQIEELKKGVDIIIAT 372


>U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2
           protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.
          Length = 660

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 323 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 382

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 383 FPKEIQMLARDFLDEYIFLAVG 404



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 44/97 (45%), Positives = 55/97 (56%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-------------RRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I    P              RR   PI+LVLAPTRELA QI + A
Sbjct: 225 GSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 284

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 285 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 321


>BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase DDX3
           protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 323 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 382

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 383 FPKEIQMLARDFLDEYIFLAVG 404



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 44/97 (45%), Positives = 55/97 (56%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-------------RRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I    P              RR   PI+LVLAPTRELA QI + A
Sbjct: 225 GSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 284

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 285 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 321


>AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 323 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 382

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 383 FPKEIQMLARDFLDEYIFLAVG 404



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 44/97 (45%), Positives = 55/97 (56%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-------------RRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I    P              RR   PI+LVLAPTRELA QI + A
Sbjct: 225 GSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 284

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 285 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 321


>AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 3 variant protein.
          Length = 674

 Score =   99 bits (238), Expect = 7e-21
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 337 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 396

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 397 FPKEIQMLARDFLDEYIFLAVG 418



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 239 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 298

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 299 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 335


>AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.
          Length = 362

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 48/82 (58%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 42  GRLADMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 101

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 102 FPKEIQMLARDFLDEYIFLAVG 123



 Score = 37.9 bits (84), Expect = 0.033
 Identities = 18/38 (47%), Positives = 24/38 (63%)
 Frame = +3

Query: 141 AADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           A  F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 3   ARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 40


>BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 46 protein.
          Length = 1031

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 46/93 (49%), Positives = 65/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +I++ +R
Sbjct: 492 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVR 551

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P+ ++ LA   L   I++ +G
Sbjct: 552 PDRQTVMFSATFPRAMEALARRILSKPIEVQVG 584



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/84 (46%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q  +  G+GPIA+++ PTRELA QI +    F  T  +R  C
Sbjct: 419 GSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVC 478

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 479 VYGGTGISEQIAELKRGAEIIVCT 502


>AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.
          Length = 1031

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 46/93 (49%), Positives = 65/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +I++ +R
Sbjct: 491 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVR 550

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P+ ++ LA   L   I++ +G
Sbjct: 551 PDRQTVMFSATFPRAMEALARRILSKPIEVQVG 583



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 38/84 (45%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q  +  G+GP+A+++ PTRELA QI +    F  T  +R  C
Sbjct: 419 GSGKTIAFLLPMFRHIMDQRSLEEGEGPLAVIMTPTRELALQIPKGVRSF-KTLGLRVVC 477

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 478 VYGGTGISEQIAELKRGAEIIVCT 501


>AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.
          Length = 1058

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 46/93 (49%), Positives = 65/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +I++ +R
Sbjct: 518 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVR 577

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P+ ++ LA   L   I++ +G
Sbjct: 578 PDRQTVMFSATFPRAMEALARRILSKPIEVQVG 610



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/84 (46%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q  +  G+GPIA+++ PTRELA QI +    F  T  +R  C
Sbjct: 445 GSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVC 504

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 505 VYGGTGISEQIAELKRGAEIIVCT 528


>BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein
           protein.
          Length = 496

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+DMGFE
Sbjct: 170 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFE 229

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 230 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 273



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 102 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 161

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 162 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 194


>BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 41 protein.
          Length = 622

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+DMGFE
Sbjct: 296 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFE 355

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 356 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 399



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 228 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 287

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 288 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 320


>AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstrakt
           variant protein.
          Length = 622

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+DMGFE
Sbjct: 296 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFE 355

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 356 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 399



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 228 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 287

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 288 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 320


>AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14862 fis, clone PLACE1001739, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+DMGFE
Sbjct: 296 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFE 355

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 356 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 399



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 228 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 287

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 288 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 320


>AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstrakt
           protein.
          Length = 621

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+DMGFE
Sbjct: 295 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFE 354

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 355 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 398



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 227 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 286

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 287 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 319


>AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10393 fis, clone NT2RM4000191, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 42/104 (40%), Positives = 58/104 (55%)
 Frame = +2

Query: 179 VCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE 358
           +C+   S K     +  G        GRL+D L+K   +L  C YL LDEADRM+D GFE
Sbjct: 296 LCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDTGFE 355

Query: 359 PQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             IR I    +  RQTL++SAT PK+++  A+  L   + IN+G
Sbjct: 356 GDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVG 399



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL + LP I+    Q    P  + +GP  L++ P+RELA+Q   +   +       
Sbjct: 228 GSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQED 287

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +  +R     GG   +EQ   +  GV +++AT
Sbjct: 288 SSPLLRCALCIGGMSVKEQMETIRHGVHMMVAT 320


>BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 4 protein.
          Length = 724

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 424 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 483

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 484 FPEEIQRLAAEFLKSNYLFVAVGQV 508



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  QI   A  F   + V
Sbjct: 335 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCV 394

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 395 RAVVIYGGTQLGHSIRQIVQGCNILCAT 422


>BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.
          Length = 690

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 390 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 449

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 450 FPEEIQRLAAEFLKSNYLFVAVGQV 474



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  +I   A  F   + V
Sbjct: 301 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNKIYLEARKFSFGTCV 360

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 361 RAVVIYGGTQLGHSIRQIVQGCNILCAT 388


>AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase
           protein.
          Length = 724

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 424 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 483

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 484 FPEEIQRLAAEFLKSNYLFVAVGQV 508



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  QI   A  F   + V
Sbjct: 335 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCV 394

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 395 RAVVIYGGTQLGHSIRQIVQGCNILCAT 422


>AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein
           protein.
          Length = 635

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 335 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 394

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 395 FPEEIQRLAAEFLKSNYLFVAVGQV 419



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  QI   A  F   + V
Sbjct: 246 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCV 305

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 306 RAVVIYGGTQLGHSIRQIVQGCNILCAT 333


>AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.
          Length = 724

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 424 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 483

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 484 FPEEIQRLAAEFLKSNYLFVAVGQV 508



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  QI   A  F   + V
Sbjct: 335 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCV 394

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 395 RAVVIYGGTQLGHSIRQIVQGCNILCAT 422


>BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 23 protein.
          Length = 820

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+++P +V I   P I R      GP A++LAPTRELAQQI++    FG    +
Sbjct: 438 GSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGI 497

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + +Q   L  G EIVIAT
Sbjct: 498 RTVAVIGGISREDQGFRLRMGCEIVIAT 525



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 46/105 (43%), Positives = 59/105 (56%), Gaps = 26/105 (24%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----RPD-------- 397
           GRLID LE     L RCTY+VLDEADRM+DMGFEP ++KI+E +     +PD        
Sbjct: 527 GRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPE 586

Query: 398 -------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
                        RQT+M++AT P  V++LA  YL     + IGS
Sbjct: 587 KMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGS 631


>AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein
           protein.
          Length = 820

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+++P +V I   P I R      GP A++LAPTRELAQQI++    FG    +
Sbjct: 438 GSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGI 497

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + +Q   L  G EIVIAT
Sbjct: 498 RTVAVIGGISREDQGFRLRMGCEIVIAT 525



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 46/105 (43%), Positives = 59/105 (56%), Gaps = 26/105 (24%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----RPD-------- 397
           GRLID LE     L RCTY+VLDEADRM+DMGFEP ++KI+E +     +PD        
Sbjct: 527 GRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPE 586

Query: 398 -------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
                        RQT+M++AT P  V++LA  YL     + IGS
Sbjct: 587 KMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGS 631


>BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 protein.
          Length = 455

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 151 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 209

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 210 KKVQKLQRAALKNPVKCAVSS 230



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 71  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 125

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 126 IVGGIDSMSQSLALAKKPHIIIAT 149


>BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.
          Length = 450

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 146 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 204

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 205 KKVQKLQRAALKNPVKCAVSS 225



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 66  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 120

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 121 IVGGIDSMSQSLALAKKPHIIIAT 144


>AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein
           protein.
          Length = 455

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 151 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 209

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 210 KKVQKLQRAALKNPVKCAVSS 230



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 71  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 125

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 126 IVGGIDSMSQSLALAKKPHIIIAT 149


>AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30012 fis, clone 3NB692000281, moderately
           similar to PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1
           IN CHROMOSOME III. ).
          Length = 455

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 151 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 209

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 210 KKVQKLQRAALKNPVKCAVSS 230



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 71  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 125

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 126 IVGGIDSMSQSLALAKKPHIIIAT 149


>AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.
          Length = 455

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 151 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 209

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 210 KKVQKLQRAALKNPVKCAVSS 230



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 71  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 125

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 126 IVGGIDSMSQSLALAKKPHIIIAT 149


>AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.
          Length = 274

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ I  DR+T ++SAT  
Sbjct: 19  GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 77

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 78  KKVQKLQRAALKNPVKCAVSS 98


>AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 isoform 1 variant protein.
          Length = 448

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 37/81 (45%), Positives = 54/81 (66%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++    DR+T ++SAT  
Sbjct: 144 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILKVNPRDRKTFLFSATMT 202

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+V+KL    L + ++  + S
Sbjct: 203 KKVQKLQRAALKNPVKCAVSS 223



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 64  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 118

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 119 IVGGIDSMSQSLALAKKPHIIIAT 142


>BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDR----QTLMWSA 421
           GR+ D L+ G  +L +  ++VLDE D+MLD+GF  Q+  II E  + D     QTL++SA
Sbjct: 268 GRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSA 327

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
           T P+ V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 328 TCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATT 361



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  +  NQ  I++   P  LVLAPTRELA Q+ +   D   T  +   
Sbjct: 184 GTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDI--TRKLSVA 241

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG   + Q   +  G++I++ T
Sbjct: 242 CFYGGTSYQSQINHIRNGIDILVGT 266


>AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDR----QTLMWSA 421
           GR+ D L+ G  +L +  ++VLDE D+MLD+GF  Q+  II E  + D     QTL++SA
Sbjct: 268 GRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSA 327

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
           T P+ V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 328 TCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATT 361



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  +  NQ  I++   P  LVLAPTRELA Q+ +   D   T  +   
Sbjct: 184 GTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDI--TRKLSVA 241

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG   + Q   +  G++I++ T
Sbjct: 242 CFYGGTSYQSQINHIRNGIDILVGT 266


>AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2
           variant protein.
          Length = 363

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDR----QTLMWSA 421
           GR+ D L+ G  +L +  ++VLDE D+MLD+GF  Q+  II E  + D     QTL++SA
Sbjct: 268 GRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSA 327

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
           T P+ V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 328 TCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATT 361



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  +  NQ  I++   P  LVLAPT ELA Q+ +   D   T  +   
Sbjct: 184 GTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTGELANQVAKDFKDI--TRKLSVA 241

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG   + Q   +  G++I++ T
Sbjct: 242 CFYGGTSYQSQINHIRNGIDILVGT 266


>AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2
           protein.
          Length = 737

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDR----QTLMWSA 421
           GR+ D L+ G  +L +  ++VLDE D+MLD+GF  Q+  II E  + D     QTL++SA
Sbjct: 268 GRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSA 327

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
           T P+ V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 328 TCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATT 361



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  +  NQ  I++   P  LVLAPTRELA Q+ +   D   T  +   
Sbjct: 184 GTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDI--TRKLSVA 241

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG   + Q   +  G++I++ T
Sbjct: 242 CFYGGTSYQSQINHIRNGIDILVGT 266


>BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ +  L     +V+DEAD ML MGF+ Q+  I+E I  D QT++ SAT P  
Sbjct: 331 GRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTS 390

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           +++LA   L + ++I  G   L
Sbjct: 391 IEQLASQLLHNPVRIITGEKNL 412



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD-FGHTSYVRNT 179
           GSGKT A++LP I+       +     P AL+L PTRELA QI++ A +       ++  
Sbjct: 250 GSGKTAAFLLPVIMRA-----LFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTV 304

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG P   Q   L++ V+++IAT
Sbjct: 305 LLVGGLPLPPQLYRLQQHVKVIIAT 329


>BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.
          Length = 434

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ +  L     +V+DEAD ML MGF+ Q+  I+E I  D QT++ SAT P  
Sbjct: 331 GRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTS 390

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           +++LA   L + ++I  G   L
Sbjct: 391 IEQLASQLLHNPVRIITGEKNL 412



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD-FGHTSYVRNT 179
           GSGKT A++LP I+       +     P AL+L PTRELA QI++ A +       ++  
Sbjct: 250 GSGKTAAFLLPVIMRA-----LFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTV 304

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG P   Q   L++ V+++IAT
Sbjct: 305 LLVGGLPLPPQLYRLQQHVKVIIAT 329


>AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ +  L     +V+DEAD ML MGF+ Q+  I+E I  D QT++ SAT P  
Sbjct: 331 GRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTS 390

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           +++LA   L + ++I  G   L
Sbjct: 391 IEQLASQLLHNPVRIITGEKNL 412



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD-FGHTSYVRNT 179
           GSGKT A++LP I+       +     P AL+L PTRELA QI++ A +       ++  
Sbjct: 250 GSGKTAAFLLPVIMRA-----LFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTV 304

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG P   Q   L++ V+++IAT
Sbjct: 305 LLVGGLPLPPQLYRLQQHVKVIIAT 329


>AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 580

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ +  L     +V+DEAD ML MGF+ Q+  I+E I  D QT++ SAT P  
Sbjct: 331 GRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTS 390

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           +++LA   L + ++I  G   L
Sbjct: 391 IEQLASQLLHNPVRIITGEKNL 412



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD-FGHTSYVRNT 179
           GSGKT A++LP I+       +     P AL+L PTRELA QI++ A +       ++  
Sbjct: 250 GSGKTAAFLLPVIMRA-----LFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTV 304

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG P   Q   L++ V+++IAT
Sbjct: 305 LLVGGLPLPPQLYRLQQHVKVIIAT 329


>BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 348 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 407

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 408 EVKDLASVSLKNPVRIFVNS 427



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 265 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 322

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 323 AVGGLDVKSQEAALRAAPDILIAT 346


>BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 348 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 407

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 408 EVKDLASVSLKNPVRIFVNS 427



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 265 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 322

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 323 AVGGLDVKSQEAALRAAPDILIAT 346


>BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 319 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 378

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 379 EVKDLASVSLKNPVRIFVNS 398



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 236 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 293

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 294 AVGGLDVKSQEAALRAAPDILIAT 317


>BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 319 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 378

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 379 EVKDLASVSLKNPVRIFVNS 398



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 236 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 293

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 294 AVGGLDVKSQEAALRAAPDILIAT 317


>BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.
          Length = 769

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 321 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 380

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 381 EVKDLASVSLKNPVRIFVNS 400



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 238 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 295

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 296 AVGGLDVKSQEAALRAAPDILIAT 319


>AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like protein
           protein.
          Length = 796

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 348 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 407

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 408 EVKDLASVSLKNPVRIFVNS 427



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 265 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 322

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 323 AVGGLDVKSQEAALRAAPDILIAT 346


>AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 348 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 407

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 408 EVKDLASVSLKNPVRIFVNS 427



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 265 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 322

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 323 AVGGLDVKSQEAALRAAPDILIAT 346


>AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 348 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 407

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 408 EVKDLASVSLKNPVRIFVNS 427



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 265 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 322

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 323 AVGGLDVKSQEAALRAAPDILIAT 346


>AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12917 fis, clone NT2RP2004568, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C30D11.03. ).
          Length = 765

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 317 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 376

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 377 EVKDLASVSLKNPVRIFVNS 396



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 234 GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 291

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 292 AVGGLDVKSQEAALRAAPDILIAT 315


>AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like protein
           protein.
          Length = 561

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 113 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 172

Query: 434 EVKKLAEDYLGDYIQINIGS 493
           EVK LA   L + ++I + S
Sbjct: 173 EVKDLASVSLKNPVRIFVNS 192



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 30  GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 87

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 88  AVGGLDVKSQEAALRAAPDILIAT 111


>D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.
          Length = 472

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++KG   +     +VLDEAD++L   F   +  II  +  +RQ L++SAT+P  
Sbjct: 213 GRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLS 272

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           V+K    +L    +IN+   L L  +T ++
Sbjct: 273 VQKFMNSHLQKPYEINLMEELTLKGVTQYY 302



 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GK+ AY++P +  ++      + D   A+V+ PTRELA Q+ Q+      H    +  
Sbjct: 132 GTGKSGAYLIPLLERLD-----LKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVM 186

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
              GG   R+    L+  V +VIAT
Sbjct: 187 ATTGGTNLRDDIMRLDDTVHVVIAT 211


>BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.
          Length = 483

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++KG   +     +VLDEAD++L   F   +  II  +  +RQ L++SAT+P  
Sbjct: 224 GRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLS 283

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           V+K    +L    +IN+   L L  +T ++
Sbjct: 284 VQKFMNSHLQKPYEINLMEELTLKGVTQYY 313



 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GK+ AY++P +  ++      + D   A+V+ PTRELA Q+ Q+      H    +  
Sbjct: 143 GTGKSGAYLIPLLERLD-----LKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVM 197

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
              GG   R+    L+  V +VIAT
Sbjct: 198 ATTGGTNLRDDIMRLDDTVHVVIAT 222


>BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.
          Length = 777

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 204 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 263

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 264 GVLMGGEKRKSEKARLRKGINILIST 289



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 291 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 349

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 350 TLTEGVTRLADISLHDPVSISV 371


>AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 775

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AL354735-1|CAI16564.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 851

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AL160165-3|CAH70532.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 775

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AL160165-2|CAH70531.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 851

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AL160165-1|CAH70530.1|  585|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 585

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AK027484-1|BAB55146.1|  585|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14578 fis, clone NT2RM4001178, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE HAS1. ).
          Length = 585

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AK027002-1|BAB15620.1|  674|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ23349 fis, clone HEP13913. ).
          Length = 674

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 101 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 160

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 161 GVLMGGEKRKSEKARLRKGINILIST 186



 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I   +  +   RQ ++ SA
Sbjct: 188 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVIPNAVNAECQKRQNVLLSA 246

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 247 TLTEGVTRLADISLHDPVSISV 268


>AF427339-1|AAL26549.1|  851|Homo sapiens DEAD/DEXH helicase DDX31
           protein.
          Length = 851

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AF335569-1|AAQ14890.1|  758|Homo sapiens helicain C protein.
          Length = 758

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AF335568-1|AAQ14889.1|  851|Homo sapiens helicain B protein.
          Length = 851

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRN 176
           GSGKTLAY +P +  +   +  I+R DGP ALVL PTRELA Q    V       +++  
Sbjct: 278 GSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVP 337

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  ++ +   L +G+ I+I+T
Sbjct: 338 GVLMGGEKRKSEKARLRKGINILIST 363



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 365 GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 423

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 424 TLTEGVTRLADISLHDPVSISV 445


>AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.
          Length = 312

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 35/76 (46%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID L    + +L     L+LDEADRMLD  FE Q+++II      RQT+++SAT   
Sbjct: 126 GRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTD 185

Query: 434 EVKKLAEDYLGDYIQI 481
           EVK LA   L + ++I
Sbjct: 186 EVKDLASVSLKNPVRI 201



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +  +P  R+      LVL PTREL  Q+  V         +    
Sbjct: 43  GTGKTAAFALPVLERLIYKP--RQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCL 100

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L    +I+IAT
Sbjct: 101 AVGGLDVKSQEAALRAAPDILIAT 124


>BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.
          Length = 467

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (7%)
 Frame = +2

Query: 269 DFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDR----QTLMWSATWPK 433
           D L+ G  +L +  ++VLDE D+MLD+GF  Q+  II E  + D     QTL++SAT P+
Sbjct: 2   DHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQ 61

Query: 434 EVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
            V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 62  WVYKVAKKYMKSRYEQVDLVGKMTQKAATT 91


>U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.
          Length = 801

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  ++ +   R RG  P  LVLAPTRELA Q+ +  +D   T  +   
Sbjct: 251 GTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDI--TKKLSVA 308

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG P   Q   +  G++I++ T
Sbjct: 309 CFYGGTPYGGQFERMRNGIDILVGT 333



 Score = 56.4 bits (130), Expect = 9e-08
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-----EQIRPDRQTLMWSA 421
           GR+ D ++ G  +L +  ++VLDE D+MLDMGF  Q+ +I+     +    + QTL++SA
Sbjct: 335 GRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSA 394

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IG-SLQLSAIT 514
           T P  V  +A+ Y+   Y Q++ IG   Q +AIT
Sbjct: 395 TCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAIT 428


>U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box RNA
           helicase-like protein mRNA, complete cds. ).
          Length = 875

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.
          Length = 745

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  ++ +   R RG  P  LVLAPTRELA Q+ +  +D   T  +   
Sbjct: 233 GTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDI--TKKLSVA 290

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG P   Q   +  G++I++ T
Sbjct: 291 CFYGGTPYGGQFERMRNGIDILVGT 315



 Score = 56.4 bits (130), Expect = 9e-08
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-----EQIRPDRQTLMWSA 421
           GR+ D ++ G  +L +  ++VLDE D+MLDMGF  Q+ +I+     +    + QTL++SA
Sbjct: 317 GRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSA 376

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IG-SLQLSAIT 514
           T P  V  +A+ Y+   Y Q++ IG   Q +AIT
Sbjct: 377 TCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAIT 410


>AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  ++ +   R RG  P  LVLAPTRELA Q+ +  +D   T  +   
Sbjct: 233 GTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDI--TKKLSVA 290

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG P   Q   +  G++I++ T
Sbjct: 291 CFYGGTPYGGQFERMRNGIDILVGT 315



 Score = 56.4 bits (130), Expect = 9e-08
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-----EQIRPDRQTLMWSA 421
           GR+ D ++ G  +L +  ++VLDE D+MLDMGF  Q+ +I+     +    + QTL++SA
Sbjct: 317 GRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSA 376

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IG-SLQLSAIT 514
           T P  V  +A+ Y+   Y Q++ IG   Q +AIT
Sbjct: 377 TCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAIT 410


>AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 variant protein.
          Length = 845

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 206 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 265

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 266 QTKSVKDLA 274



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 126 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 184

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 185 IIGGKDLKHEAERI-NNINILVCT 207


>AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.
          Length = 875

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 196 CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 255

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 256 QTKSVKDLA 264



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  +         DG   L+++PTRELA Q  +V    G         
Sbjct: 116 GSGKTLAFLVPVLEALYRLQWTST-DGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGL 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + +A  +   + I++ T
Sbjct: 175 IIGGKDLKHEAERI-NNINILVCT 197


>AB001343-1|BAA20386.1|  111|Homo sapiens DDX10-NUP98 fusion protein
           type 2 protein.
          Length = 111

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++  + +      LVLDEADR+LDMGF   +  +IE +   RQTL++SAT
Sbjct: 5   CTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSAT 64

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 65  QTKSVKDLA 73


>D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.
          Length = 412

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 166 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHE 225

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 226 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 256



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 86  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 140

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 141 CIGGTNVGEDIRKLDYGQHVVAGT 164


>CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.
          Length = 411

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHE 224

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 225 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 255



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 85  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 139

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 140 CIGGTNVGEDIRKLDYGQHVVAGT 163


>BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHE 224

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 225 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 255



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 85  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 139

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 140 CIGGTNVGEDIRKLDYGQHVVAGT 163


>BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHE 224

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 225 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 255



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 85  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 139

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 140 CIGGTNVGEDIRKLDYGQHVVAGT 163


>BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHE 224

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 225 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 255



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 85  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 139

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 140 CIGGTNVGEDIRKLDYGQHVVAGT 163


>AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu protein
           protein.
          Length = 715

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ +P I  ++ +   R RG  P  LVLAPTREL  Q+ +  +D   T  +   
Sbjct: 165 GTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELCNQVSKDFSDI--TKKLSVA 222

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG P   Q   +  G++I++ T
Sbjct: 223 CFYGGTPYGGQFERMRNGIDILVGT 247



 Score = 56.4 bits (130), Expect = 9e-08
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-----EQIRPDRQTLMWSA 421
           GR+ D ++ G  +L +  ++VLDE D+MLDMGF  Q+ +I+     +    + QTL++SA
Sbjct: 249 GRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSA 308

Query: 422 TWPKEVKKLAEDYL-GDYIQIN-IG-SLQLSAIT 514
           T P  V  +A+ Y+   Y Q++ IG   Q +AIT
Sbjct: 309 TCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAIT 342


>X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.
          Length = 610

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 238 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 297

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 298 RQTMLFSATQTRKVEDLA 315



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 166 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 220

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 221 TYGLIMGGSNRSAEAQKLGNGINIIVAT 248


>CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.
          Length = 610

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 238 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 297

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 298 RQTMLFSATQTRKVEDLA 315



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 166 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 220

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 221 TYGLIMGGSNRSAEAQKLGNGINIIVAT 248


>BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 298 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 357

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 358 RQTMLFSATQTRKVEDLA 375



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 226 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 280

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 281 TYGLIMGGSNRSAEAQKLGNGINIIVAT 308


>BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.
          Length = 864

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+    + +  LQ   Y+V DEADR+ +MGF  Q+++II ++    QT+++SAT PK 
Sbjct: 208 GRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKL 267

Query: 437 VKKLAEDYLGDYIQINI 487
           + + A   L + + I +
Sbjct: 268 LVEFARAGLTEPVLIRL 284



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  ++LP    +          G  AL+L+PTRELA Q  +   + G  + ++   
Sbjct: 126 GSGKTACFLLPMFERLKTHSA---QTGARALILSPTRELALQTLKFTKELGKFTGLKTAL 182

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q   L    +I+IAT
Sbjct: 183 ILGGDRMEDQFAALHENPDIIIAT 206


>BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 298 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 357

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 358 RQTMLFSATQTRKVEDLA 375



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 226 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 280

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 281 TYGLIMGGSNRSAEAQKLGNGINIIVAT 308


>BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 298 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 357

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 358 RQTMLFSATQTRKVEDLA 375



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 226 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 280

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 281 TYGLIMGGSNRSAEAQKLGNGINIIVAT 308


>AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase DP97
           protein.
          Length = 865

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+    + +  LQ   Y+V DEADR+ +MGF  Q+++II ++    QT+++SAT PK 
Sbjct: 209 GRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKL 268

Query: 437 VKKLAEDYLGDYIQINI 487
           + + A   L + + I +
Sbjct: 269 LVEFARAGLTEPVLIRL 285



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  ++LP    +          G  AL+L+PTRELA Q  +   + G  + ++   
Sbjct: 127 GSGKTACFLLPMFERLKTHSA---QTGARALILSPTRELALQTLKFTKELGKFTGLKTAL 183

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q   L    +I+IAT
Sbjct: 184 ILGGDRMEDQFAALHENPDIIIAT 207


>AK091227-1|BAC03616.1|  408|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33908 fis, clone CTONG2008518, highly similar to
           DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18. ).
          Length = 408

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 36  LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 95

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 96  RQTMLFSATQTRKVEDLA 113


>AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10605 fis, clone NT2RP2005126, highly similar to
           H.sapiens mRNA for RNA helicase. ).
          Length = 670

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 298 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 357

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 358 RQTMLFSATQTRKVEDLA 375



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN-T 179
           GSGKTLA+++PA+  I     + R +G   L+L+PTRELA Q   V  +   T +V    
Sbjct: 226 GSGKTLAFLIPAVELIVKLRFMTR-NGTGVLILSPTRELAMQTFGVLKEL-MTHHVHTYG 283

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG+ +  +A+ L  G+ I++AT
Sbjct: 284 LIMGGSNRSAEAQKLGNGINIIVAT 308


>AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 882

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+    + +  LQ   Y+V DEADR+ +MGF  Q+++II ++    QT+++SAT PK 
Sbjct: 225 GRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKL 284

Query: 437 VKKLAEDYLGDYIQINI 487
           + + A   L + + I +
Sbjct: 285 LVEFARAGLTEPVLIRL 301



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  ++LP    +          G  AL+L+PTRELA Q  +   + G  + ++   
Sbjct: 143 GSGKTACFLLPMFERLKTHSA---QTGARALILSPTRELALQTLKFTKELGKFTGLKTAL 199

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q   L    +I+IAT
Sbjct: 200 ILGGDRMEDQFAALHENPDIIIAT 223


>AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.
          Length = 546

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           LG G        GRL+D ++     + +    LV+DEADR+LD+GFE ++++II+ +   
Sbjct: 174 LGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTR 233

Query: 398 RQTLMWSATWPKEVKKLA 451
           RQT+++SAT  ++V+ LA
Sbjct: 234 RQTMLFSATQTRKVEDLA 251



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PA   IV +   P  R G G   L+L+PTRELA Q   V  +   T +V 
Sbjct: 102 GSGKTLAFLIPAVELIVKLRFMP--RNGTG--VLILSPTRELAMQTFGVLKEL-MTHHVH 156

Query: 174 N-TCVFGGAPKREQARDLERGVEIVIAT 254
               + GG+ +  +A+ L  G+ I++AT
Sbjct: 157 TYGLIMGGSNRSAEAQKLGNGINIIVAT 184


>AK023695-1|BAB14644.1|  556|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13633 fis, clone PLACE1011114, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE HAS1. ).
          Length = 556

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ--RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSA 421
           GRL+D + K T N+   R  +LV DEADR+LD+GFE  I  I+  +  +   RQ ++ SA
Sbjct: 70  GRLVDHI-KSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSA 128

Query: 422 TWPKEVKKLAEDYLGDYIQINI 487
           T  + V +LA+  L D + I++
Sbjct: 129 TLTEGVTRLADISLHDPVSISV 150



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 66  IRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEI 242
           I+R DGP ALVL PTRELA Q    V       +++    + GG  ++ +   L +G+ I
Sbjct: 5   IQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINI 64

Query: 243 VIAT 254
           +I+T
Sbjct: 65  LIST 68


>X79538-1|CAA56074.1|  411|Homo sapiens translation initiation
           factor protein.
          Length = 411

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + + +   +    LVLDEAD ML+ GF+ QI  +   +    Q ++ SAT P E
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPSATQVVLISATLPHE 224

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 225 ILEMTNKFMTDPIRILVKRDELTLEGIKQFF 255



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 29/84 (34%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++ Q  +R      AL+LAPTRELA QIQ+     G    V+   
Sbjct: 85  GTGKTATFSISVLQCLDIQ--VRETQ---ALILAPTRELAVQIQKGLLALGDYMNVQCHA 139

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  +V  T
Sbjct: 140 CIGGTNVGEDIRKLDYGQHVVAGT 163


>D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation factor
           4AI protein.
          Length = 406

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 219

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 220 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 250



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 79  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 131

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 132 HACIGGTNVRAEVQKLQMEAPHIIVGT 158


>BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 219

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 220 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 250



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 79  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 131

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 132 HACIGGTNVRAEVQKLQMEAPHIIVGT 158


>BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 219

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 220 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 250



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 79  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 131

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 132 HACIGGTNVRAEVQKLQMEAPHIIVGT 158


>BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 219

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 220 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 250



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 79  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 131

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 132 HACIGGTNVRAEVQKLQMEAPHIIVGT 158


>BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 219

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 220 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 250



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 79  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 131

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 132 HACIGGTNVRAEVQKLQMEAPHIIVGT 158


>BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for
           IMAGE:4099962) protein.
          Length = 473

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 227 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 286

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 287 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 317



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 146 GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 198

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 199 HACIGGTNVRAEVQKLQMEAPHIIVGT 225


>AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant
           protein.
          Length = 375

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI  I +++  + Q ++ SAT P +
Sbjct: 158 GRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSD 217

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 218 VLEVTKKFMRDPIRILVKKEELTLEGIRQFY 248



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I       +     ALVLAPTRELAQQIQ+V    G   Y+  +C
Sbjct: 77  GTGKTATFAISILQQIELDLKATQ-----ALVLAPTRELAQQIQKVVMALG--DYMGASC 129

Query: 183 --VFGGAPKREQARDLE-RGVEIVIAT 254
               GG   R + + L+     I++ T
Sbjct: 130 HACIGGTNVRAEVQKLQMEAPHIIVGT 156


>BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 protein.
          Length = 483

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 39/108 (36%), Positives = 54/108 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  ++  P      G   LVL PTRELA QI +     G    +++  
Sbjct: 49  GSGKTAAFVLPILQKLSEDPY-----GIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCI 103

Query: 183 VFGGAPKREQARDLERGVEIVIATQVD*LISWKRAQPTYSGAHI*FLM 326
           + GG     QA +L R   +VIAT    L    R+  T+S   I FL+
Sbjct: 104 IVGGMDMVAQALELSRKPHVVIATP-GRLADHLRSSNTFSIKKIRFLV 150



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D L    T ++++  +LV+DEADR+L+ G   F   +  I+  +   RQTL++SAT
Sbjct: 129 GRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSAT 188

Query: 425 WPKEVKKL 448
               +++L
Sbjct: 189 LTDTLREL 196


>AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 variant protein.
          Length = 483

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 39/108 (36%), Positives = 54/108 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  ++  P      G   LVL PTRELA QI +     G    +++  
Sbjct: 49  GSGKTAAFVLPILQKLSEDPY-----GIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCI 103

Query: 183 VFGGAPKREQARDLERGVEIVIATQVD*LISWKRAQPTYSGAHI*FLM 326
           + GG     QA +L R   +VIAT    L    R+  T+S   I FL+
Sbjct: 104 IVGGMDMVAQALELSRKPHVVIATP-GRLADHLRSSNTFSIKKIRFLV 150



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D L    T ++++  +LV+DEADR+L+ G   F   +  I+  +   RQTL++SAT
Sbjct: 129 GRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSAT 188

Query: 425 WPKEVKKL 448
               +++L
Sbjct: 189 LTDTLREL 196


>AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.
          Length = 483

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 39/108 (36%), Positives = 54/108 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  ++  P      G   LVL PTRELA QI +     G    +++  
Sbjct: 49  GSGKTAAFVLPILQKLSEDPY-----GIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCI 103

Query: 183 VFGGAPKREQARDLERGVEIVIATQVD*LISWKRAQPTYSGAHI*FLM 326
           + GG     QA +L R   +VIAT    L    R+  T+S   I FL+
Sbjct: 104 IVGGMDMVAQALELSRKPHVVIATP-GRLADHLRSSNTFSIKKIRFLV 150



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D L    T ++++  +LV+DEADR+L+ G   F   +  I+  +   RQTL++SAT
Sbjct: 129 GRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSAT 188

Query: 425 WPKEVKKL 448
               +++L
Sbjct: 189 LTDTLREL 196


>AB000267-1|BAA20379.1|  124|Homo sapiens NUP98-DDX10 fusion protein
           type 1 protein.
          Length = 124

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 26/46 (56%), Positives = 33/46 (71%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLA 451
           +VLDEADR+LDMGF   +  +IE +   RQTL++SAT  K VK LA
Sbjct: 44  VVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLA 89


>BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q ++ SAT P +
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTD 220

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 221 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 251



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 104 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 159


>BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q ++ SAT P +
Sbjct: 162 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTD 221

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 222 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 252



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 105 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 160


>BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 55 protein.
          Length = 600

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADR+LDMGFE  I  I+E +   R+T ++SAT  +EV+ L    L + +++++
Sbjct: 168 LVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSV 225



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF-GHTSYVRN 176
           GSGKTLA+++P + + +  +  +++     A+++ PTRELA QI +V + F  H      
Sbjct: 56  GSGKTLAFVIPILEILLRREEKLKKSQVG-AIIITPTRELAIQIDEVLSHFTKHFPEFSQ 114

Query: 177 TCVFGGA-PKREQARDLERGVEIVIAT 254
               GG  P  +  R  ++G  I++AT
Sbjct: 115 ILWIGGRNPGEDVERFKQQGGNIIVAT 141


>BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q ++ SAT P +
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTD 220

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 221 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 251



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 104 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 159


>BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q ++ SAT P +
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTD 220

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 221 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 251



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 104 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 159


>BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q ++ SAT P +
Sbjct: 162 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTD 221

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 222 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 252



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 105 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 160


>AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16577 fis, clone TESTI2026647, weakly  similar
           to PROBABLE ATP-DEPENDENT RNA HELICASE DDX10. ).
          Length = 267

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADR+LDMGFE  I  I+E +   R+T ++SAT  +EV+ L    L + +++++
Sbjct: 21  LVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSV 78


>AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10432 fis, clone NT2RP1000470, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 257

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 39/108 (36%), Positives = 54/108 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  ++  P      G   LVL PTRELA QI +     G    +++  
Sbjct: 49  GSGKTAAFVLPILQKLSEDPY-----GIFCLVLTPTRELAYQIAERFRVLGKPLGLKDCI 103

Query: 183 VFGGAPKREQARDLERGVEIVIATQVD*LISWKRAQPTYSGAHI*FLM 326
           + GG     QA +L R   +VIAT    L    R+  T+S   I FL+
Sbjct: 104 IVGGMDMVAQALELSRKPHVVIATP-GRLADHLRSSNTFSIKKIRFLV 150



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D L    T ++++  +LV+DEADR+L+ G   F   +  I+  +   RQTL++SAT
Sbjct: 129 GRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSAT 188

Query: 425 WPKEVKKL 448
               +++L
Sbjct: 189 LTDTLREL 196


>AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.
          Length = 471

 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADR+LDMGFE  I  I+E +   R+T ++SAT  +EV+ L    L + +++++
Sbjct: 39  LVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSV 96


>AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23639 fis, clone CAS11535. ).
          Length = 353

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADR+LDMGFE  I  I+E +   R+T ++SAT  +EV+ L    L + +++++
Sbjct: 168 LVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATRTQEVENLVRAGLRNPVRVSV 225



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF-GHTSYVRN 176
           GSGKTLA+++P + + +  +  +++     A+++ PTRELA QI +V + F  H      
Sbjct: 56  GSGKTLAFVIPILEILLRREEKLKKSQVG-AIIITPTRELAIQIDEVLSHFTKHFPEFSQ 114

Query: 177 TCVFGGA-PKREQARDLERGVEIVIAT 254
               GG  P  +  R  ++G  I++AT
Sbjct: 115 ILWIGGRNPGEDVERFKQQGGNIIVAT 141


>D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation factor
           4AII protein.
          Length = 407

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L +   + +     VLDEAD ML  GF+ QI +I +++    Q +  SAT P +
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVFASATMPTD 220

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++ + ++ D I+I +    L L  I  F+
Sbjct: 221 VLEVTKKFMRDPIRILVKKEELTLEGIKQFY 251



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTC--VFGGAPKREQARDLE-RGVEIVIAT 254
           ALVLAPTRELAQQIQ+V    G   Y+  TC    GG   R + + L+     IV+ T
Sbjct: 104 ALVLAPTRELAQQIQKVILALG--DYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT 159


>D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.
          Length = 439

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA++LP +  I+  P +++      L+LAP++ELA Q   VA ++G    V  T 
Sbjct: 42  GTGKTLAFLLPILSRID--PKVKQTQ---VLILAPSQELAMQTTAVAREWGALVDVSVTS 96

Query: 183 VFGGAPKREQARDLERG-VEIVIAT 254
           + GGA  R QA  L++    IV+ T
Sbjct: 97  LIGGANGRRQADKLKKDKPHIVVGT 121



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/90 (26%), Positives = 47/90 (52%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++  L+ G   L     ++ DEAD ML       ++ +  Q+  D Q  ++SAT   +
Sbjct: 123 GRVLTMLDGGALKLNGLQTVIFDEADAMLSDERRDSLQALAAQLPTDVQLGLFSATSGVD 182

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITTFFK 526
           +K +A+ +  +   +++G+   +AIT  F+
Sbjct: 183 LKYVADTFGQEVRPVSVGTDAPAAITHEFQ 212


>BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 28 protein.
          Length = 540

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKTL+Y+LP +  +  QP +       P  LVL P+RELAQQ++ VA   G +  +  
Sbjct: 175 GSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLV 234

Query: 177 TCVFGGAPKREQARDLER--GVEIVIAT 254
             + GG   R     L R    ++++AT
Sbjct: 235 RDLEGGHGMRRIRLQLSRQPSADVLVAT 262



 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ 385
           G L   L+    +L++ ++LVLDEAD +LD  F   +  I+E+
Sbjct: 264 GALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEK 306


>AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16192 fis, clone BRTHA2017364, weakly  similar
           to ATP-DEPENDENT RNA HELICASE T26G10.1 IN CHROMOSOME
           III. ).
          Length = 528

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIV-----HINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKTLAY+ P I       +  +        P  LVLAPT ELA Q+         +  
Sbjct: 171 GSGKTLAYLAPIIQLLRLEELEGRSSKSSSQAPRVLVLAPTAELASQVLDNCRSLSKSGV 230

Query: 168 -VRNTCVFGGAPKREQARDLERGVEIVIAT 254
             ++  V GG  ++ Q  +L++GV+++IAT
Sbjct: 231 PFKSMVVTGGFRQKTQLENLQQGVDVLIAT 260


>AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11282 fis, clone PLACE1009476, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 540

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKTL+Y+LP +  +  QP +       P  LVL P+RELAQQ++ VA   G +  +  
Sbjct: 175 GSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLV 234

Query: 177 TCVFGGAPKREQARDLER--GVEIVIAT 254
             + GG   R     L R    ++++AT
Sbjct: 235 RDLEGGHGMRRIRLQLSRQPSADVLVAT 262



 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ 385
           G L   L+    +L++ ++LVLDEAD +LD  F   +  I+E+
Sbjct: 264 GALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEK 306


>AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helicase
           MDDX28 protein.
          Length = 540

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKTL+Y+LP +  +  QP +       P  LVL P+RELAQQ++ VA   G +  +  
Sbjct: 175 GSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLV 234

Query: 177 TCVFGGAPKREQARDLER--GVEIVIAT 254
             + GG   R     L R    ++++AT
Sbjct: 235 RDLEGGHGMRRIRLQLSRQPSADVLVAT 262



 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ 385
           G L   L+    +L++ ++LVLDEAD +LD  F   +  I+E+
Sbjct: 264 GALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEK 306


>EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47
           isoform 1 variant protein.
          Length = 182

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I++   + P R      ALVL PTRELA QI +     G +  V++  
Sbjct: 60  GSGKTGAFALP-ILNALLETPQRL----FALVLTPTRELAFQISEQFEALGSSIGVQSAV 114

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+  L +   I+IAT
Sbjct: 115 IVGGIDSMSQSLALAKKPHIIIAT 138



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE 382
           GRLID LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++
Sbjct: 140 GRLIDHLENTKGF-NLRALKYLVMDEADRILNMDFETEVDKILK 182


>AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.
          Length = 284

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 30  GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPXEKQVMMFSATLSK 89

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 90  EIRPVCRKFMQDPMEI 105


>Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEAD
           family) protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BX248516-5|CAM25876.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 96  GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 155

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 156 EIRPVCRKFMQDPMEI 171


>BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent
           RNA helicase protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662847-22|CAO72085.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 96  GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 155

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 156 EIRPVCRKFMQDPMEI 171


>AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662801-5|CAM25576.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 96  GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 155

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 156 EIRPVCRKFMQDPMEI 171


>AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.
          Length = 284

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 30  GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 89

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 90  EIRPVCRKFMQDPMEI 105


>AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.
          Length = 443

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 189 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 248

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 249 EIRPVCRKFMQDPMEI 264


>AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGDYIQI 481
           E++ +   ++ D ++I
Sbjct: 234 EIRPVCRKFMQDPMEI 249


>BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.
          Length = 254

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D L    T ++++  +LV+DEADR+L+ G   F   +  I+  +   RQTL++SAT
Sbjct: 22  GRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSAT 81

Query: 425 WPKEVKKL 448
               +++L
Sbjct: 82  LTDTLREL 89


>AK056044-1|BAB71082.1|  189|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31482 fis, clone NT2NE2001666, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE YDL031W. ).
          Length = 189

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-NQPPIRRGDGPIALVLAPTRELAQQIQQVAADF 152
           G+GKT ++ +P I  +  NQ  I++   P  LVLAPTRELA    QVA DF
Sbjct: 119 GTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELA---NQVAKDF 166


>BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVKKLAEDYLGD 469
           E++ +   ++ D
Sbjct: 234 EIRPVCRKFMQD 245


>BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase
           Gemin3 protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP103
           protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.
          Length = 824

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +  ++K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKV 282


>AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 310

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 194 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 253

Query: 434 EVKKLAEDYLGD 469
           E++ +   ++ D
Sbjct: 254 EIRPVCRKFMQD 265


>X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protein
           family protein.
          Length = 740

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQIRPD---RQTLMWS 418
           GRL D +  G  NL +  +LVLDEAD +L  G+   I ++   I Q+  D    Q ++ S
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    +VKKL+E
Sbjct: 408 ATLHSFDVKKLSE 420



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGH---TSYVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P AL++ P+RELA+Q       F        +R   + GG   R+Q   LE GV+IV+
Sbjct: 285 NAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVV 344

Query: 249 AT--QVD*LIS 275
            T  ++D L+S
Sbjct: 345 GTPGRLDDLVS 355


>EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQIRPD---RQTLMWS 418
           GRL D +  G  NL +  +LVLDEAD +L  G+   I ++   I Q+  D    Q ++ S
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    +VKKL+E
Sbjct: 408 ATLHSFDVKKLSE 420



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGH---TSYVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P AL++ P+RELA+Q       F        +R   + GG   R+Q   LE GV+IV+
Sbjct: 285 NAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVV 344

Query: 249 AT--QVD*LIS 275
            T  ++D L+S
Sbjct: 345 GTPGRLDDLVS 355


>EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQIRPD---RQTLMWS 418
           GRL D +  G  NL +  +LVLDEAD +L  G+   I ++   I Q+  D    Q ++ S
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    +VKKL+E
Sbjct: 408 ATLHSFDVKKLSE 420



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGH---TSYVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P AL++ P+RELA+Q       F        +R   + GG   R+Q   LE GV+IV+
Sbjct: 285 NAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVV 344

Query: 249 AT--QVD*LIS 275
            T  ++D L+S
Sbjct: 345 GTPGRLDDLVS 355


>BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQIRPD---RQTLMWS 418
           GRL D +  G  NL +  +LVLDEAD +L  G+   I ++   I Q+  D    Q ++ S
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    +VKKL+E
Sbjct: 408 ATLHSFDVKKLSE 420



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGH---TSYVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P AL++ P+RELA+Q       F        +R   + GG   R+Q   LE GV+IV+
Sbjct: 285 NAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVV 344

Query: 249 AT--QVD*LIS 275
            T  ++D L+S
Sbjct: 345 GTPGRLDDLVS 355


>BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQIRPD---RQTLMWS 418
           GRL D +  G  NL +  +LVLDEAD +L  G+   I ++   I Q+  D    Q ++ S
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    +VKKL+E
Sbjct: 408 ATLHSFDVKKLSE 420



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGH---TSYVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P AL++ P+RELA+Q       F        +R   + GG   R+Q   LE GV+IV+
Sbjct: 285 NAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVV 344

Query: 249 AT--QVD*LIS 275
            T  ++D L+S
Sbjct: 345 GTPGRLDDLVS 355


>BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.
          Length = 316

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/81 (23%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +   + +L+   + VLDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 173 GRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK 232

Query: 434 EVKKLAEDYLGDYIQINIGSL 496
           +++ +   ++ D  +  + +L
Sbjct: 233 DIRPVCRKFMQDVSRARVAAL 253


>AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10644 fis, clone NT2RP2005763, weakly similar to
           EUKARYOTIC INITIATION FACTOR 4A. ).
          Length = 824

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG-FEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+   +E    N       +LDEAD++L+ G F+ QI  I   +   +Q L  SAT+P+
Sbjct: 189 GRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPE 248

Query: 434 EVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
            +      Y+ D  ++++N     L  +   +K+
Sbjct: 249 FLANALTKYMRDPTFVRLNSSDPSLIGLKQCYKV 282


>U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase
           protein.
          Length = 427

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/76 (23%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +   + +L+   + VLDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 173 GRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK 232

Query: 434 EVKKLAEDYLGDYIQI 481
           +++ +   ++ D +++
Sbjct: 233 DIRPVCRKFMQDPMEV 248


>BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.
          Length = 804

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 334 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 389



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 406 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 454


>BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.
          Length = 322

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/76 (23%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +   + +L+   + VLDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 173 GRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK 232

Query: 434 EVKKLAEDYLGDYIQI 481
           +++ +   ++ D +++
Sbjct: 233 DIRPVCRKFMQDPMEV 248


>BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 389 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 444



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 461 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 509


>BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 389 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 444



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 461 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 509


>BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39 protein.
          Length = 427

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/76 (23%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +   + +L+   + VLDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 173 GRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK 232

Query: 434 EVKKLAEDYLGDYIQI 481
           +++ +   ++ D +++
Sbjct: 233 DIRPVCRKFMQDPMEV 248


>AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22961 fis, clone KAT10214. ).
          Length = 461

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/76 (23%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +   + +L+   + VLDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 207 GRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK 266

Query: 434 EVKKLAEDYLGDYIQI 481
           +++ +   ++ D +++
Sbjct: 267 DIRPVCRKFMQDPMEV 282


>AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21509 fis, clone COL05745. ).
          Length = 859

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 389 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 444



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 461 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 509


>AJ010931-1|CAA09408.1|  111|Homo sapiens p68 RNA helicase protein.
          Length = 111

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 17/20 (85%), Positives = 20/20 (100%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP 62
           GSGKTL+Y+LPAIVHIN+QP
Sbjct: 89  GSGKTLSYLLPAIVHINHQP 108


>AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 859

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 389 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 444



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 461 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 509


>AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 variant protein.
          Length = 676

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  IALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + LVL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 395 LGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 450



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 467 NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 515


>BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT  K
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK 233

Query: 434 EVK 442
           E++
Sbjct: 234 EIR 236


>AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 454

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 88  NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 136



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +3

Query: 96  VLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           VL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 71


>AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 486

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPDRQTLMWSAT 424
           NL++   LV+DEADRM++ G   ++ +++E     Q  P RQTL++SAT
Sbjct: 88  NLRQLRCLVVDEADRMVEKGHFAELSQLLEMLNDSQYNPKRQTLVFSAT 136



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +3

Query: 96  VLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           VL PTRELA Q++Q        + ++   + GG   ++Q R L R  EIV+AT
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVAT 71


>CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.
          Length = 547

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R++  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L + + + +   QL
Sbjct: 204 VQALKELILHNPVTLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 protein.
          Length = 547

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R++  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L + + + +   QL
Sbjct: 204 VQALKELILHNPVTLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase
           protein.
          Length = 547

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R++  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L + + + +   QL
Sbjct: 204 VQALKELILHNPVTLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase
           protein.
          Length = 547

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R++  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L + + + +   QL
Sbjct: 204 VQALKELILHNPVTLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 52 protein.
          Length = 599

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQ 137
           GSGKTLA+ +P ++ +    P  +G    AL+++PTRELA QI +
Sbjct: 212 GSGKTLAFSIPILMQLKQ--PANKGFR--ALIISPTRELASQIHR 252


>AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36342 fis, clone THYMU2006666, highly similar to
           Homo sapiens putative ATP-dependent RNA helicase ROK1
           mRNA. ).
          Length = 360

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQ 137
           GSGKTLA+ +P ++ +    P  +G    AL+++PTRELA QI +
Sbjct: 104 GSGKTLAFSIPILMQLKQ--PANKGFR--ALIISPTRELASQIHR 144


>AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12712 fis, clone NT2RP1001080, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE DBP9. ).
          Length = 547

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R +  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RTLSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L + + + +   QL
Sbjct: 204 VQALKELILHNPVTLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10790 fis, clone NT2RP4000518, weakly similar to
           ATP-DEPENDENT RNA HELICASE ROK1. ).
          Length = 491

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQ 137
           GSGKTLA+ +P ++ +    P  +G    AL+++PTRELA QI +
Sbjct: 104 GSGKTLAFSIPILMQLKQ--PANKGFR--ALIISPTRELASQIHR 144


>AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 420

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQ 137
           GSGKTLA+ +P ++ +    P  +G    AL+++PTRELA QI +
Sbjct: 33  GSGKTLAFSIPILMQLKQ--PANKGFR--ALIISPTRELASQIHR 73


>AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helicase
           ROK1 isoform a variant protein.
          Length = 512

 Score = 38.3 bits (85), Expect = 0.025
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQ 137
           GSGKTLA+ +P ++ +    P  +G    AL+++PTRELA QI +
Sbjct: 211 GSGKTLAFSIPILMQLKQ--PANKGFR--ALIISPTRELASQIHR 251


>AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 variant protein.
          Length = 547

 Score = 37.9 bits (84), Expect = 0.033
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           R++  L++ +  L+     LV+DEAD +   GFE +++ ++  +    Q  + SAT+ ++
Sbjct: 144 RILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           V+ L E  L +   + +   QL
Sbjct: 204 VQALKELILHNPATLKLQESQL 225



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA------LVLAPTRELAQQIQQV 140
           GSGKT AY +P +  + +    R+  GP+       LVL PT+ELA+Q Q +
Sbjct: 54  GSGKTAAYAIPMLQLLLH----RKATGPVVEQAVRGLVLVPTKELARQAQSM 101


>AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39759 fis, clone SMINT2019153, weakly similar to
           ATP-DEPENDENT RNA HELICASE DBP73D. ).
          Length = 666

 Score = 36.7 bits (81), Expect = 0.076
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  + ++          ALV+ PT+ELAQQ+ +V   +   + +R + 
Sbjct: 259 GSGKTLAFVIPVVQALLSRVVCHIR----ALVVLPTKELAQQVSKVFNIYTDATPLRVSL 314

Query: 183 VFG 191
           V G
Sbjct: 315 VTG 317



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 14/42 (33%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKII 379
           GRL+D +++    +LQ+  +L++DEADRM+D   +  + +++
Sbjct: 348 GRLVDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVV 389


>BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSAT 230


>AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSAT 230


>AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GR++      + NL+   + +LDE D+ML+ +     +++I      ++Q +M+SAT
Sbjct: 174 GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSAT 230


>BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G ++D+  K    +L +    VLDEAD M+D  GF     +I   +  + Q L++SAT+ 
Sbjct: 110 GTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFE 169

Query: 431 KEVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
             V   AE  + D   I++    L L+ I  ++ L
Sbjct: 170 DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVL 204



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N          P  L LAPT ELA Q  +V    G
Sbjct: 32  GTGKTAAFVLAMLSRVNALELF-----PQCLCLAPTYELALQTGRVVEQMG 77


>BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 51 protein.
          Length = 666

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +  + ++          ALV+ PT+ELA+Q+ +V   +   + +R + 
Sbjct: 259 GSGKTLAFVIPVVQALLSRVVCHIR----ALVVLPTKELARQVSKVFNIYTDATPLRVSL 314

Query: 183 VFG 191
           V G
Sbjct: 315 VTG 317



 Score = 33.9 bits (74), Expect = 0.54
 Identities = 14/42 (33%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKII 379
           GRL+D +++    +LQ+  +L++DEADRM+D   +  + +++
Sbjct: 348 GRLVDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVV 389


>BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G ++D+  K    +L +    VLDEAD M+D  GF     +I   +  + Q L++SAT+ 
Sbjct: 110 GTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFE 169

Query: 431 KEVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
             V   AE  + D   I++    L L+ I  ++ L
Sbjct: 170 DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVL 204



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N          P  L LAPT ELA Q  +V    G
Sbjct: 32  GTGKTAAFVLAMLSRVNALELF-----PQCLCLAPTYELALQTGRVVEQMG 77


>AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase-GRTH/DDX25 protein.
          Length = 483

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G ++D+  K    +L +    VLDEAD M+D  GF     +I   +  + Q L++SAT+ 
Sbjct: 224 GTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFE 283

Query: 431 KEVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
             V   AE  + D   I++    L L+ I  ++ L
Sbjct: 284 DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVL 318



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N          P  L LAPT ELA Q  +V    G
Sbjct: 146 GTGKTAAFVLAMLSRVNALELF-----PQCLCLAPTYELALQTGRVVEQMG 191


>AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 205

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 353 FEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQL 502
           F+ Q+  I+E I  D QT++ SAT P  +++LA   L + ++I  G   L
Sbjct: 1   FQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNL 50


>AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase protein.
          Length = 483

 Score = 35.1 bits (77), Expect = 0.23
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G ++D+  K    +L +    VLDEAD M+D  GF     +I   +  + Q L++SAT+ 
Sbjct: 224 GTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFE 283

Query: 431 KEVKKLAEDYLGD--YIQINIGSLQLSAITTFFKL 529
             V   AE  + D   I++    L L+ I  ++ L
Sbjct: 284 DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVL 318



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N          P  L LAPT ELA Q  +V    G
Sbjct: 146 GTGKTAAFVLAMLSRVNALELF-----PQCLCLAPTYELALQTGRVVEQMG 191


>BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.
          Length = 187

 Score = 33.9 bits (74), Expect = 0.54
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           G+GK+ AY++P +  ++      + D   A+V+ PTRELA Q+ Q+
Sbjct: 143 GTGKSGAYLIPLLERLD-----LKKDNIQAMVIVPTRELALQVSQI 183


>BC018637-1|AAH18637.2|  423|Homo sapiens DDX50 protein protein.
          Length = 423

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 2/41 (4%)
 Frame = +2

Query: 401 QTLMWSATWPKEVKKLAEDYL-GDYIQIN-IGSLQLSAITT 517
           QTL++SAT P+ V K+A+ Y+   Y Q++ +G +   A TT
Sbjct: 7   QTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATT 47


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,221,646
Number of Sequences: 237096
Number of extensions: 2244144
Number of successful extensions: 8633
Number of sequences better than 10.0: 231
Number of HSP's better than 10.0 without gapping: 8086
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8452
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7727256732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -