SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ271736-3|CAB96818.1|  190|Homo sapiens hypothetical protein pr...    38   0.042
Y18448-1|CAA77176.1| 3851|Homo sapiens Bassoon protein protein.        33   0.68 
AF052224-1|AAC83555.1| 3926|Homo sapiens neuronal double zinc fi...    33   0.68 
AB007894-1|BAA23707.1| 1571|Homo sapiens KIAA0434 protein.             33   0.68 
U31501-1|AAC50292.1|  673|Homo sapiens fragile X mental retardat...    32   1.6  
BT009817-1|AAP88819.1|  673|Homo sapiens fragile X mental retard...    32   1.6  
BC067272-1|AAH67272.1|  673|Homo sapiens fragile X mental retard...    32   1.6  
BC051907-1|AAH51907.1|  673|Homo sapiens fragile X mental retard...    32   1.6  
BC020090-1|AAH20090.1|  673|Homo sapiens fragile X mental retard...    32   1.6  
AL356115-1|CAI40902.1|  588|Homo sapiens KIAA1128 protein.             32   1.6  
AK024324-1|BAB14884.1|  701|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AF387615-1|AAL91356.1|   46|Homo sapiens gm139 protein.                32   1.6  
AF241785-1|AAG44473.1|  566|Homo sapiens NPD012 protein.               32   1.6  
AB032954-1|BAA86442.1|  588|Homo sapiens KIAA1128 protein protein.     32   1.6  
BC146754-1|AAI46755.1|  926|Homo sapiens storkhead box 2 protein.      32   2.1  
AB037813-1|BAA92630.1|  950|Homo sapiens KIAA1392 protein protein.     32   2.1  
U82808-1|AAD00539.1|  491|Homo sapiens muscle-specific serine ki...    31   3.6  
DQ099381-1|AAZ13757.1|  566|Homo sapiens serine/threonine kinase...    31   3.6  
BC117124-1|AAI17125.1|  566|Homo sapiens SFRS protein kinase 3 p...    31   3.6  
BC092416-1|AAH92416.1|  567|Homo sapiens SFRS protein kinase 3 p...    31   3.6  
BC008455-1|AAH08455.1|  259|Homo sapiens uncharacterized hematop...    31   3.6  
AF220052-1|AAF67645.1|  259|Homo sapiens uncharacterized hematop...    31   3.6  
AF027406-1|AAD01848.1|  533|Homo sapiens muscle-specific serine ...    31   3.6  
AB209155-1|BAD92392.1|  699|Homo sapiens serine/threonine kinase...    31   3.6  
AB097050-1|BAC77403.1|  259|Homo sapiens putative MAPK activatin...    31   3.6  
AK055096-1|BAB70854.1|  155|Homo sapiens protein ( Homo sapiens ...    27   4.1  
AB209299-1|BAD92536.1|  954|Homo sapiens aldehyde dehydrogenase ...    31   4.8  
BC009449-1|AAH09449.1|  569|Homo sapiens MGC2641 protein protein.      30   6.4  
AY358600-1|AAQ88963.1|  671|Homo sapiens HGDF-related pro 2 prot...    30   6.4  
AF294267-1|AAP97281.1|  671|Homo sapiens hepatoma-derived growth...    30   6.4  
X98801-1|CAA67333.1| 1263|Homo sapiens dynactin protein.               30   8.4  
U90445-1|AAD00701.1|  405|Homo sapiens p150Glued homolog protein.      30   8.4  
BC071583-1|AAH71583.1| 1139|Homo sapiens DCTN1 protein protein.        30   8.4  
BC026916-1|AAH26916.1|  408|Homo sapiens SERPINE1 mRNA binding p...    30   8.4  
BC019273-1|AAH19273.1|  408|Homo sapiens SERPINE1 mRNA binding p...    30   8.4  
BC011993-1|AAH11993.1|  380|Homo sapiens hypothetical protein LO...    30   8.4  
BC008045-1|AAH08045.1|  408|Homo sapiens SERPINE1 mRNA binding p...    30   8.4  
BC003049-1|AAH03049.1|  408|Homo sapiens SERPINE1 mRNA binding p...    30   8.4  
AY032853-1|AAK51130.1|  309|Homo sapiens CGI-55 protein.               30   8.4  
AL590559-3|CAH73323.1|  408|Homo sapiens PAI-1 mRNA-binding prot...    30   8.4  
AL590559-1|CAH73326.1|  393|Homo sapiens PAI-1 mRNA-binding prot...    30   8.4  
AK128697-1|BAC87576.1|  211|Homo sapiens protein ( Homo sapiens ...    30   8.4  
AK074970-1|BAC11324.1|  408|Homo sapiens protein ( Homo sapiens ...    30   8.4  
AK022498-1|BAB14060.1|  302|Homo sapiens protein ( Homo sapiens ...    30   8.4  
AF151813-1|AAD34050.1|  393|Homo sapiens CGI-55 protein protein.       30   8.4  
AF086947-1|AAD03694.1| 1261|Homo sapiens dynactin 1 protein.           30   8.4  
AF064205-2|AAD55812.1| 1144|Homo sapiens dynactin 1 p135 isoform...    30   8.4  
AF064205-1|AAD55811.1| 1278|Homo sapiens dynactin 1 p150 isoform...    30   8.4  

>AJ271736-3|CAB96818.1|  190|Homo sapiens hypothetical protein
           protein.
          Length = 190

 Score = 37.5 bits (83), Expect = 0.042
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = -3

Query: 458 TPWPVPGRGPCQPRRDLGARLRGPSLFPRP 369
           TP P   RGPC+PRR  G RL     FP P
Sbjct: 27  TPTPTLNRGPCRPRRQAGRRLLDTVSFPSP 56



 Score = 31.1 bits (67), Expect = 3.6
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%)
 Frame = -2

Query: 120 SRSGPSAAPSCP*TRPSS---GDCLSSNRLYRAPCQKSRQ 10
           +R G +  P+ P T PSS   G C  +  L R PC+  RQ
Sbjct: 3   TRWGTNTTPTAPTTTPSSXGAGQCTPTPTLNRGPCRPRRQ 42


>Y18448-1|CAA77176.1| 3851|Homo sapiens Bassoon protein protein.
          Length = 3851

 Score = 33.5 bits (73), Expect = 0.68
 Identities = 18/53 (33%), Positives = 23/53 (43%)
 Frame = +2

Query: 32   ARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
            AR+S  D  + PE+G +  HD    G       H  G   R  GRH G +  R
Sbjct: 3538 ARHSYHDYDEPPEEG-LWPHDEGGPGRHASAKEHRHGDHGRHSGRHTGEEPGR 3589


>AF052224-1|AAC83555.1| 3926|Homo sapiens neuronal double zinc finger
            protein protein.
          Length = 3926

 Score = 33.5 bits (73), Expect = 0.68
 Identities = 18/53 (33%), Positives = 23/53 (43%)
 Frame = +2

Query: 32   ARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
            AR+S  D  + PE+G +  HD    G       H  G   R  GRH G +  R
Sbjct: 3613 ARHSYHDYDEPPEEG-LWPHDEGGPGRHASAKEHRHGDHGRHSGRHTGEEPGR 3664


>AB007894-1|BAA23707.1| 1571|Homo sapiens KIAA0434 protein.
          Length = 1571

 Score = 33.5 bits (73), Expect = 0.68
 Identities = 18/53 (33%), Positives = 23/53 (43%)
 Frame = +2

Query: 32   ARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
            AR+S  D  + PE+G +  HD    G       H  G   R  GRH G +  R
Sbjct: 1258 ARHSYHDYDEPPEEG-LWPHDEGGPGRHASAKEHRHGDHGRHSGRHTGEEPGR 1309


>U31501-1|AAC50292.1|  673|Homo sapiens fragile X mental retardation
           syndrome related protein protein.
          Length = 673

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 443 PGRGPCQPRRDLGARLRGPSLFPRPTWRSTARR*LSIV*DP 321
           P RG    RR  G R RGP   PRPT R  +    S++ DP
Sbjct: 474 PTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDP 514


>BT009817-1|AAP88819.1|  673|Homo sapiens fragile X mental
           retardation, autosomal homolog 2 protein.
          Length = 673

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 443 PGRGPCQPRRDLGARLRGPSLFPRPTWRSTARR*LSIV*DP 321
           P RG    RR  G R RGP   PRPT R  +    S++ DP
Sbjct: 474 PTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDP 514


>BC067272-1|AAH67272.1|  673|Homo sapiens fragile X mental
           retardation, autosomal homolog 2 protein.
          Length = 673

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 443 PGRGPCQPRRDLGARLRGPSLFPRPTWRSTARR*LSIV*DP 321
           P RG    RR  G R RGP   PRPT R  +    S++ DP
Sbjct: 474 PTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDP 514


>BC051907-1|AAH51907.1|  673|Homo sapiens fragile X mental
           retardation, autosomal homolog 2 protein.
          Length = 673

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 443 PGRGPCQPRRDLGARLRGPSLFPRPTWRSTARR*LSIV*DP 321
           P RG    RR  G R RGP   PRPT R  +    S++ DP
Sbjct: 474 PTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDP 514


>BC020090-1|AAH20090.1|  673|Homo sapiens fragile X mental
           retardation, autosomal homolog 2 protein.
          Length = 673

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 443 PGRGPCQPRRDLGARLRGPSLFPRPTWRSTARR*LSIV*DP 321
           P RG    RR  G R RGP   PRPT R  +    S++ DP
Sbjct: 474 PTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDP 514


>AL356115-1|CAI40902.1|  588|Homo sapiens KIAA1128 protein.
          Length = 588

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +2

Query: 131 HHRGGRDRQPGRHH-----GGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQ 295
           HH G  D   G  +     G  E    +P   + K  VD  E      + T  + HM   
Sbjct: 368 HHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT--LRHMVQD 425

Query: 296 EHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDL 442
              V+TQ+  LKRL+     S +  D +++   S   +D D+  K+ DL
Sbjct: 426 CTAVKTQLLKLKRLLHQHDGSGSLHDIQLSLPSSPEPEDGDKVYKNEDL 474


>AK024324-1|BAB14884.1|  701|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14262 fis, clone PLACE1001608. ).
          Length = 701

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +2

Query: 131 HHRGGRDRQPGRHH-----GGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQ 295
           HH G  D   G  +     G  E    +P   + K  VD  E      + T  + HM   
Sbjct: 585 HHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT--LRHMVQD 642

Query: 296 EHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDL 442
              V+TQ+  LKRL+     S +  D +++   S   +D D+  K+ DL
Sbjct: 643 CTAVKTQLLKLKRLLHQHDGSGSLHDIQLSLPSSPEPEDGDKVYKNEDL 691


>AF387615-1|AAL91356.1|   46|Homo sapiens gm139 protein.
          Length = 46

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +2

Query: 74  GRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGG 178
           G  +GH+ AA GP R    HH+G R  Q   H  G
Sbjct: 7   GEPRGHEAAARGPHRAAR-HHQGPRGAQDAEHPAG 40


>AF241785-1|AAG44473.1|  566|Homo sapiens NPD012 protein.
          Length = 566

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +2

Query: 131 HHRGGRDRQPGRHH-----GGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQ 295
           HH G  D   G  +     G  E    +P   + K  VD  E      + T  + HM   
Sbjct: 346 HHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT--LRHMVQD 403

Query: 296 EHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDL 442
              V+TQ+  LKRL+     S +  D +++   S   +D D+  K+ DL
Sbjct: 404 CTAVKTQLLKLKRLLHQHDGSGSLHDIQLSLPSSPEPEDGDKVYKNEDL 452


>AB032954-1|BAA86442.1|  588|Homo sapiens KIAA1128 protein protein.
          Length = 588

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +2

Query: 131 HHRGGRDRQPGRHH-----GGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQ 295
           HH G  D   G  +     G  E    +P   + K  VD  E      + T  + HM   
Sbjct: 368 HHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT--LRHMVQD 425

Query: 296 EHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDL 442
              V+TQ+  LKRL+     S +  D +++   S   +D D+  K+ DL
Sbjct: 426 CTAVKTQLLKLKRLLHQHDGSGSLHDIQLSLPSSPEPEDGDKVYKNEDL 474


>BC146754-1|AAI46755.1|  926|Homo sapiens storkhead box 2 protein.
          Length = 926

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = -3

Query: 164 GPAGGPAPRDGVQDARAPGHLLLHHVPE 81
           GP GGPA   GV +  A G L+ HH  E
Sbjct: 660 GPGGGPAASGGVAEGIANGRLVQHHGAE 687


>AB037813-1|BAA92630.1|  950|Homo sapiens KIAA1392 protein protein.
          Length = 950

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = -3

Query: 164 GPAGGPAPRDGVQDARAPGHLLLHHVPE 81
           GP GGPA   GV +  A G L+ HH  E
Sbjct: 684 GPGGGPAASGGVAEGIANGRLVQHHGAE 711


>U82808-1|AAD00539.1|  491|Homo sapiens muscle-specific serine
           kinase 1 protein.
          Length = 491

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 392 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 450

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 451 KYEWPLEQATQFSA 464


>DQ099381-1|AAZ13757.1|  566|Homo sapiens serine/threonine kinase 23
           protein.
          Length = 566

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 467 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 525

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 526 KYEWPLEQATQFSA 539


>BC117124-1|AAI17125.1|  566|Homo sapiens SFRS protein kinase 3
           protein.
          Length = 566

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 467 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 525

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 526 KYEWPLEQATQFSA 539


>BC092416-1|AAH92416.1|  567|Homo sapiens SFRS protein kinase 3
           protein.
          Length = 567

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 468 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 526

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 527 KYEWPLEQATQFSA 540


>BC008455-1|AAH08455.1|  259|Homo sapiens uncharacterized
           hematopoietic stem/progenitor cells protein MDS032
           protein.
          Length = 259

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 4/94 (4%)
 Frame = +2

Query: 239 EYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVT---ASQSSAKSDAE-IAKALSVVH 406
           E +S+      L  H + QE L E +M  L R + T   A+QS  K D + ++ +L +  
Sbjct: 151 EKQSAAELDLVLQRHQNLQEKLAE-EMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMAD 209

Query: 407 QDLDEADKDRDLEPAKVSLEPNQILTGIGIIVCF 508
           Q+L++   + +          N +L  + IIVCF
Sbjct: 210 QNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCF 243


>AF220052-1|AAF67645.1|  259|Homo sapiens uncharacterized
           hematopoietic stem/progenitor cells protein MDS032
           protein.
          Length = 259

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 4/94 (4%)
 Frame = +2

Query: 239 EYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVT---ASQSSAKSDAE-IAKALSVVH 406
           E +S+      L  H + QE L E +M  L R + T   A+QS  K D + ++ +L +  
Sbjct: 151 EKQSAAELDLVLQRHQNLQEKLAE-EMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMAD 209

Query: 407 QDLDEADKDRDLEPAKVSLEPNQILTGIGIIVCF 508
           Q+L++   + +          N +L  + IIVCF
Sbjct: 210 QNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCF 243


>AF027406-1|AAD01848.1|  533|Homo sapiens muscle-specific serine
           kinase 1 protein.
          Length = 533

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 434 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 492

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 493 KYEWPLEQATQFSA 506


>AB209155-1|BAD92392.1|  699|Homo sapiens serine/threonine kinase 23
           variant protein.
          Length = 699

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +2

Query: 161 GRHHGGDEDR----VRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH--LVETQMK 322
           G  +  DED     V L G   P F + +G Y   F  +   + H+HN +H  L E  M+
Sbjct: 600 GEDYSRDEDHIAHIVELLGDIPPAFAL-SGRYSREFFNRRGELRHIHNLKHWGLYEVLME 658

Query: 323 DLKRLIVTASQSSA 364
             +  +  A+Q SA
Sbjct: 659 KYEWPLEQATQFSA 672


>AB097050-1|BAC77403.1|  259|Homo sapiens putative MAPK activating
           protein protein.
          Length = 259

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 4/94 (4%)
 Frame = +2

Query: 239 EYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVT---ASQSSAKSDAE-IAKALSVVH 406
           E +S+      L  H + QE L E +M  L R + T   A+QS  K D + ++ +L +  
Sbjct: 151 EKQSAAELDLVLQRHQNLQEKLAE-EMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMAD 209

Query: 407 QDLDEADKDRDLEPAKVSLEPNQILTGIGIIVCF 508
           Q+L++   + +          N +L  + IIVCF
Sbjct: 210 QNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCF 243


>AK055096-1|BAB70854.1|  155|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30534 fis, clone BRAWH2001141. ).
          Length = 155

 Score = 26.6 bits (56), Expect(2) = 4.1
 Identities = 14/26 (53%), Positives = 14/26 (53%)
 Frame = -3

Query: 464 PATPWPVPGRGPCQPRRDLGARLRGP 387
           PAT    PGRGP     DLGA   GP
Sbjct: 80  PATRLATPGRGPGGRGWDLGALRVGP 105



 Score = 23.0 bits (47), Expect(2) = 4.1
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -3

Query: 593 RIPKSNFPSPG*ILTSQLTLPRMLP 519
           R+P+   P+PG + +SQL   R+LP
Sbjct: 18  RVPRPP-PTPGGVPSSQLRPERLLP 41


>AB209299-1|BAD92536.1|  954|Homo sapiens aldehyde dehydrogenase 1
           family, member L1 variant protein.
          Length = 954

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 467 VPATPWPVPGRGPCQPRRDLGARLRGPSLF 378
           +P TP P P RGP  P   +   + G SLF
Sbjct: 34  LPGTPAPTPARGPSNPPATMKIAVIGQSLF 63


>BC009449-1|AAH09449.1|  569|Homo sapiens MGC2641 protein protein.
          Length = 569

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +2

Query: 50  DDKQSPEDGRVQG-HDGAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           D ++ P  G  +  HD   +GP+ +RP   R  R+R  G     DE+
Sbjct: 522 DSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEE 568


>AY358600-1|AAQ88963.1|  671|Homo sapiens HGDF-related pro 2
           protein.
          Length = 671

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +2

Query: 50  DDKQSPEDGRVQG-HDGAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           D ++ P  G  +  HD   +GP+ +RP   R  R+R  G     DE+
Sbjct: 624 DSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEE 670


>AF294267-1|AAP97281.1|  671|Homo sapiens hepatoma-derived growth
           factor 2 protein.
          Length = 671

 Score = 30.3 bits (65), Expect = 6.4
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +2

Query: 50  DDKQSPEDGRVQG-HDGAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           D ++ P  G  +  HD   +GP+ +RP   R  R+R  G     DE+
Sbjct: 624 DSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEE 670


>X98801-1|CAA67333.1| 1263|Homo sapiens dynactin protein.
          Length = 1263

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 727 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 756


>U90445-1|AAD00701.1|  405|Homo sapiens p150Glued homolog protein.
          Length = 405

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 334 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 363


>BC071583-1|AAH71583.1| 1139|Homo sapiens DCTN1 protein protein.
          Length = 1139

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 608 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 637


>BC026916-1|AAH26916.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>BC019273-1|AAH19273.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>BC011993-1|AAH11993.1|  380|Homo sapiens hypothetical protein
           LOC79714 protein.
          Length = 380

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 9/30 (30%), Positives = 21/30 (70%)
 Frame = +3

Query: 6   IVASIFGTVLGIAGSTINNHLKMAEFRDMM 95
           ++ S+ G ++G+AGST  N +++ E + ++
Sbjct: 174 LIGSVLGALIGVAGSTYVNRVRLQELKALL 203


>BC008045-1|AAH08045.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>BC003049-1|AAH03049.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>AY032853-1|AAK51130.1|  309|Homo sapiens CGI-55 protein.
          Length = 309

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 55  EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 114

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 115 SDRSSFSHYSGL 126


>AL590559-3|CAH73323.1|  408|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>AL590559-1|CAH73326.1|  393|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 393

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>AK128697-1|BAC87576.1|  211|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46864 fis, clone UTERU3011579. ).
          Length = 211

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = -3

Query: 479 GFDLVPATPWPVPGRGPCQPRRDLGARLRGPS 384
           G ++  +  WP+P  G C    DLGARL GPS
Sbjct: 141 GLEVSASAAWPLPAPGDCS---DLGARL-GPS 168


>AK074970-1|BAC11324.1|  408|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90489 fis, clone NT2RP3003473, moderately
           similar to PAI-1 mRNA-binding protein. ).
          Length = 408

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>AK022498-1|BAB14060.1|  302|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12436 fis, clone NT2RM1000062. ).
          Length = 302

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 9/30 (30%), Positives = 21/30 (70%)
 Frame = +3

Query: 6   IVASIFGTVLGIAGSTINNHLKMAEFRDMM 95
           ++ S+ G ++G+AGST  N +++ E + ++
Sbjct: 96  LIGSVLGALIGVAGSTYVNRVRLQELKALL 125


>AF151813-1|AAD34050.1|  393|Homo sapiens CGI-55 protein protein.
          Length = 393

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           + P + + +G + + D P  +RP+  RGG  R  G    G             +F+  +G
Sbjct: 139 EKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSG 198

Query: 239 EYKSSFSKQTSL 274
             +SSFS  + L
Sbjct: 199 SDRSSFSHYSGL 210


>AF086947-1|AAD03694.1| 1261|Homo sapiens dynactin 1 protein.
          Length = 1261

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 725 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 754


>AF064205-2|AAD55812.1| 1144|Homo sapiens dynactin 1 p135 isoform
           protein.
          Length = 1144

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 608 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 637


>AF064205-1|AAD55811.1| 1278|Homo sapiens dynactin 1 p150 isoform
           protein.
          Length = 1278

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 405 CTTERAFAISASDLALDCEAVTINRLRSFI 316
           CT + A  I  +  ALDC +V + RLR+F+
Sbjct: 742 CTMQLADHIKFTQSALDCMSVEVGRLRAFL 771


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,127,579
Number of Sequences: 237096
Number of extensions: 2175096
Number of successful extensions: 7669
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 6930
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7649
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7422585720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -