SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L05092-1|AAC15856.1|  178|Homo sapiens ribosomal protein L11 pro...   153   5e-37
BC018970-1|AAH18970.1|  177|Homo sapiens ribosomal protein L11 p...   153   5e-37
AY871274-1|AAX11430.1|  177|Homo sapiens cell growth-inhibiting ...   153   5e-37
AL451000-5|CAH71474.1|  174|Homo sapiens ribosomal protein L11 p...   153   5e-37
AL451000-3|CAH71472.1|  178|Homo sapiens ribosomal protein L11 p...   153   5e-37
AF432212-1|AAL99919.1|  176|Homo sapiens CLL-associated antigen ...   153   5e-37
AF101385-1|AAD20460.3|  177|Homo sapiens ribosomal protein L11 p...   153   5e-37
X79234-1|CAA55816.1|  178|Homo sapiens ribosomal protein L11 pro...   148   1e-35
AL451000-4|CAH71473.1|  131|Homo sapiens ribosomal protein L11 p...   132   7e-31
AB007171-1|BAA25831.1|   36|Homo sapiens ribosomal protein L11 p...    75   2e-13
U31973-1|AAA96392.1|  858|Homo sapiens phosphodiesterase A' subu...    32   1.4  
U20212-1|AAA92886.1|  858|Homo sapiens cone photoreceptor cGMP-p...    32   1.4  
AL356214-7|CAH72330.1|  858|Homo sapiens phosphodiesterase 6C, c...    32   1.4  
AL157396-4|CAH73839.1|  858|Homo sapiens phosphodiesterase 6C, c...    32   1.4  

>L05092-1|AAC15856.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 77  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 136

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 137 PGFSIADKKRRTGCIGAKHRISKE 160



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 65  NEKIAVHCTVRGAKAEEIL 83



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 159 KEEAMRWFQQKYDG 172


>BC018970-1|AAH18970.1|  177|Homo sapiens ribosomal protein L11
           protein.
          Length = 177

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 76  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 135

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 136 PGFSIADKKRRTGCIGAKHRISKE 159



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 64  NEKIAVHCTVRGAKAEEIL 82



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 158 KEEAMRWFQQKYDG 171


>AY871274-1|AAX11430.1|  177|Homo sapiens cell growth-inhibiting
           protein 34 protein.
          Length = 177

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 76  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 135

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 136 PGFSIADKKRRTGCIGAKHRISKE 159



 Score =  130 bits (315), Expect = 3e-30
 Identities = 63/79 (79%), Positives = 67/79 (84%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRL RAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLARAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 64  NEKIAVHCTVRGAKAEEIL 82



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 158 KEEAMRWFQQKYDG 171


>AL451000-5|CAH71474.1|  174|Homo sapiens ribosomal protein L11
           protein.
          Length = 174

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 75  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 134

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 135 PGFSIADKKRRTGCIGAKHRISKE 158



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 63  NEKIAVHCTVRGAKAEEIL 81


>AL451000-3|CAH71472.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 77  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 136

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 137 PGFSIADKKRRTGCIGAKHRISKE 160



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 65  NEKIAVHCTVRGAKAEEIL 83



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 159 KEEAMRWFQQKYDG 172


>AF432212-1|AAL99919.1|  176|Homo sapiens CLL-associated antigen
           KW-12 protein.
          Length = 176

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 75  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 134

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 135 PGFSIADKKRRTGCIGAKHRISKE 158



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 63  NEKIAVHCTVRGAKAEEIL 81



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 157 KEEAMRWFQQKYDG 170


>AF101385-1|AAD20460.3|  177|Homo sapiens ribosomal protein L11
           protein.
          Length = 177

 Score =  153 bits (371), Expect = 5e-37
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 76  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 135

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 136 PGFSIADKKRRTGCIGAKHRISKE 159



 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 64  NEKIAVHCTVRGAKAEEIL 82



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 158 KEEAMRWFQQKYDG 171


>X79234-1|CAA55816.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  148 bits (359), Expect = 1e-35
 Identities = 66/84 (78%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVRE ELR++NFS TGNFGFGIQEHIDLGI+YDPSIGIYGLDFYVVLGR
Sbjct: 77  AKAEEILEKGLKVRELELRKNNFSDTGNFGFGIQEHIDLGIEYDPSIGIYGLDFYVVLGR 136

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 137 PGFSIADKKRRTGCIGAKHRISKE 160



 Score =  128 bits (308), Expect = 2e-29
 Identities = 62/79 (78%), Positives = 66/79 (83%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESG RLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGGRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHC VR  K ++ L
Sbjct: 65  NEKIAVHCAVRGAKAEEIL 83



 Score = 30.3 bits (65), Expect = 5.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 501 KGSAMKWFQQKYDG 542
           K  AM+WFQQKYDG
Sbjct: 159 KEEAMRWFQQKYDG 172


>AL451000-4|CAH71473.1|  131|Homo sapiens ribosomal protein L11
           protein.
          Length = 131

 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 63  NEKIAVHCTVRGAKAEEIL 81



 Score =  116 bits (279), Expect = 7e-26
 Identities = 53/57 (92%), Positives = 56/57 (98%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVV 426
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVV
Sbjct: 75  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVV 131


>AB007171-1|BAA25831.1|   36|Homo sapiens ribosomal protein L11
           protein.
          Length = 36

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 35/36 (97%), Positives = 35/36 (97%)
 Frame = +2

Query: 77  IRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSK 184
           IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSK
Sbjct: 1   IRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSK 36


>U31973-1|AAA96392.1|  858|Homo sapiens phosphodiesterase A' subunit
           protein.
          Length = 858

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +2

Query: 47  NSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSF 208
           N  +++  LH      NI    S   +  A KV E+LT  +  F KA YTVRS+
Sbjct: 218 NFVSIILRLHHTSYMYNIESRRSQILMWSANKVFEELTDVERQFHKALYTVRSY 271


>U20212-1|AAA92886.1|  858|Homo sapiens cone photoreceptor
           cGMP-phosphodiesterase alpha' subunit protein.
          Length = 858

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +2

Query: 47  NSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSF 208
           N  +++  LH      NI    S   +  A KV E+LT  +  F KA YTVRS+
Sbjct: 218 NFVSIILRLHHTSYMYNIESRRSQILMWSANKVFEELTDVERQFHKALYTVRSY 271


>AL356214-7|CAH72330.1|  858|Homo sapiens phosphodiesterase 6C,
           cGMP-specific, cone, alpha prime protein.
          Length = 858

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +2

Query: 47  NSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSF 208
           N  +++  LH      NI    S   +  A KV E+LT  +  F KA YTVRS+
Sbjct: 218 NFVSIILRLHHTSYMYNIESRRSQILMWSANKVFEELTDVERQFHKALYTVRSY 271


>AL157396-4|CAH73839.1|  858|Homo sapiens phosphodiesterase 6C,
           cGMP-specific, cone, alpha prime protein.
          Length = 858

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +2

Query: 47  NSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSF 208
           N  +++  LH      NI    S   +  A KV E+LT  +  F KA YTVRS+
Sbjct: 218 NFVSIILRLHHTSYMYNIESRRSQILMWSANKVFEELTDVERQFHKALYTVRSY 271


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 84,946,245
Number of Sequences: 237096
Number of extensions: 1915277
Number of successful extensions: 11382
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 11261
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11382
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6635341780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -