SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z93242-7|CAI42729.1|  234|Homo sapiens sex comb on midleg-like 1...    32   2.4  
BC022089-1|AAH22089.1|  971|Homo sapiens DIS3 mitotic control ho...    30   9.6  
AK095407-1|BAC04542.1|  750|Homo sapiens protein ( Homo sapiens ...    30   9.6  

>Z93242-7|CAI42729.1|  234|Homo sapiens sex comb on midleg-like 1
           (Drosophila) protein.
          Length = 234

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = +3

Query: 264 KMVLPIFDEDDNQFKMTI-ARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFH 440
           K  +P +DEDDN        +    NKE  I  +   S    +++  ++ ++   Q+I+ 
Sbjct: 13  KTRIPTYDEDDNTILYAYETKPEFVNKEPNI--VSDASCNTEEQLKTVDDVLIHCQVIYD 70

Query: 441 LIYNNEEAVNVICDNLKYTEVSQRHA-TRYTQRLR-NYKKHS 560
            + N ++ ++VI    K +++ + HA + +T   R  YKKHS
Sbjct: 71  ALQNLDKKIDVI--RRKVSKIQRFHARSLWTNHKRYGYKKHS 110


>BC022089-1|AAH22089.1|  971|Homo sapiens DIS3 mitotic control
           homolog (S. cerevisiae)-like protein.
          Length = 971

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +3

Query: 501 VSQRHATRYTQRLRNYKKHSRHHKPEHVLFACVARRIAFFRRDQRPNASRWCWRSII*QL 680
           V  +   R   +LRN  K +RH   + +LFA   ++  +  R++  +  +W  RSI    
Sbjct: 8   VQHQRGRRQYNKLRNLLKDARH---DCILFANEFQQCCYLPRERGESMEKWQTRSIYNAA 64

Query: 681 QWIF 692
            W +
Sbjct: 65  VWYY 68


>AK095407-1|BAC04542.1|  750|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38088 fis, clone CTONG2020031, weakly similar to
           Mitotic control protein dis3. ).
          Length = 750

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +3

Query: 501 VSQRHATRYTQRLRNYKKHSRHHKPEHVLFACVARRIAFFRRDQRPNASRWCWRSII*QL 680
           V  +   R   +LRN  K +RH   + +LFA   ++  +  R++  +  +W  RSI    
Sbjct: 91  VQHQRGRRQYNKLRNLLKDARH---DCILFANEFQQCCYLPRERGESMEKWQTRSIYNAA 147

Query: 681 QWIF 692
            W +
Sbjct: 148 VWYY 151


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,859,042
Number of Sequences: 237096
Number of extensions: 1911633
Number of successful extensions: 3268
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3265
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -