SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U45878-1|AAC50371.1|  604|Homo sapiens inhibitor of apoptosis pr...    33   0.80 
U37546-1|AAC50507.1|  604|Homo sapiens MIHC protein.                   33   0.80 
L49432-1|AAC41943.1|  604|Homo sapiens TNFR2-TRAF signalling com...    33   0.80 
BC037420-1|AAH37420.1|  604|Homo sapiens baculoviral IAP repeat-...    33   0.80 
AY764389-1|AAU88144.1|  604|Homo sapiens baculoviral IAP repeat-...    33   0.80 
AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein...    33   0.80 
AF070674-1|AAC83232.1|  604|Homo sapiens inhibitor of apoptosis ...    33   0.80 
U45879-1|AAC50372.1|  618|Homo sapiens inhibitor of apoptosis pr...    32   1.8  
U37547-1|AAC50508.1|  618|Homo sapiens MIHB protein.                   32   1.8  
L49431-1|AAC41942.1|  618|Homo sapiens TNFR2-TRAF signalling com...    32   1.8  
DQ068066-1|AAY46158.1|  618|Homo sapiens baculoviral IAP repeat-...    32   1.8  
BC028578-1|AAH28578.1|  618|Homo sapiens BIRC2 protein protein.        32   1.8  
BC016174-1|AAH16174.1|  618|Homo sapiens baculoviral IAP repeat-...    32   1.8  
AF207599-1|AAN73272.1|  534|Homo sapiens pRb-interacting protein...    32   1.8  
U45880-1|AAC50373.1|  497|Homo sapiens X-linked inhibitor of apo...    31   4.3  
U32974-1|AAC50518.1|  497|Homo sapiens IAP-like protein ILP prot...    31   4.3  
BC032729-1|AAH32729.1|  497|Homo sapiens baculoviral IAP repeat-...    31   4.3  
AY886519-1|AAW62257.1|  497|Homo sapiens baculoviral IAP repeat-...    31   4.3  
AL121601-4|CAB95312.1|  497|Homo sapiens baculoviral IAP repeat-...    31   4.3  
AL121601-3|CAI42584.1|  156|Homo sapiens baculoviral IAP repeat-...    31   4.3  
AB209184-1|BAD92421.1|  184|Homo sapiens insulin-like growth fac...    30   7.4  

>U45878-1|AAC50371.1|  604|Homo sapiens inhibitor of apoptosis
           protein 1 protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>U37546-1|AAC50507.1|  604|Homo sapiens MIHC protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>L49432-1|AAC41943.1|  604|Homo sapiens TNFR2-TRAF signalling
           complex protein protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>BC037420-1|AAH37420.1|  604|Homo sapiens baculoviral IAP
           repeat-containing 3 protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AY764389-1|AAU88144.1|  604|Homo sapiens baculoviral IAP
           repeat-containing 3 protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein
           protein.
          Length = 1140

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>AF070674-1|AAC83232.1|  604|Homo sapiens inhibitor of apoptosis
           protein-1 protein.
          Length = 604

 Score = 33.5 bits (73), Expect = 0.80
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C +   +
Sbjct: 49  SLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 99


>U45879-1|AAC50372.1|  618|Homo sapiens inhibitor of apoptosis
           protein 2 protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>U37547-1|AAC50508.1|  618|Homo sapiens MIHB protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>L49431-1|AAC41942.1|  618|Homo sapiens TNFR2-TRAF signalling
           complex protein protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>DQ068066-1|AAY46158.1|  618|Homo sapiens baculoviral IAP
           repeat-containing 2 protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>BC028578-1|AAH28578.1|  618|Homo sapiens BIRC2 protein protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>BC016174-1|AAH16174.1|  618|Homo sapiens baculoviral IAP
           repeat-containing 2 protein.
          Length = 618

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>AF207599-1|AAN73272.1|  534|Homo sapiens pRb-interacting protein
           RbBP-36 protein.
          Length = 534

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  V+D V C  C   + NW   +     H  L P C++   +
Sbjct: 66  SLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNL 116


>U45880-1|AAC50373.1|  497|Homo sapiens X-linked inhibitor of
           apotosis protein protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>U32974-1|AAC50518.1|  497|Homo sapiens IAP-like protein ILP
           protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>BC032729-1|AAH32729.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>AY886519-1|AAW62257.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>AL121601-4|CAB95312.1|  497|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>AL121601-3|CAI42584.1|  156|Homo sapiens baculoviral IAP
           repeat-containing 4 protein.
          Length = 156

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +  W   +     H  +SP C + N
Sbjct: 51  GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIN 94


>AB209184-1|BAD92421.1|  184|Homo sapiens insulin-like growth factor
           1 (somatomedin C); insulin-like growth factor 1 (som
           protein.
          Length = 184

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 341 SFWFSDTFIWPSLVFVSALMTCTVDKLCSKLQTRTRKCLICSWL 210
           S W S  FI P+  F+  L T       S L T+  KC  C +L
Sbjct: 8   SLWISFCFIIPANQFIFRLCTSEAMGKISSLPTQLFKCCFCDFL 51


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,630,036
Number of Sequences: 237096
Number of extensions: 1694675
Number of successful extensions: 3536
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 3400
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3536
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8679165170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -