SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK026688-1|BAB15527.1|  282|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AL645608-6|CAI15568.1|  749|Homo sapiens novel protein protein.        42   0.002
BC060851-1|AAH60851.1|  742|Homo sapiens LOC401010 protein protein.    42   0.002
BC003555-1|AAH03555.1|  749|Homo sapiens nucleolar complex assoc...    42   0.002
AK022756-1|BAB14230.1|  521|Homo sapiens protein ( Homo sapiens ...    42   0.002
AL606467-2|CAI41431.1|  175|Homo sapiens chromosome X open readi...    33   1.0  

>AK026688-1|BAB15527.1|  282|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ23035 fis, clone LNG02033. ).
          Length = 282

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 25/68 (36%), Positives = 36/68 (52%)
 Frame = +3

Query: 303 GPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETIKPKKDLRISVYLNDKPA 482
           GP+ ++AG S  I FKNVF     F I VD   F ++   E+++PKK   I+V     P+
Sbjct: 189 GPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTIRA-GESVRPKKINNITVSFEGNPS 247

Query: 483 QGWTEVPT 506
              T + T
Sbjct: 248 GSKTPITT 255


>AL645608-6|CAI15568.1|  749|Homo sapiens novel protein protein.
          Length = 749

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 15/34 (44%), Positives = 29/34 (85%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITRNQQ 614
           +M L++++++WST EE++RVLAFL + R+ R+++
Sbjct: 292 RMLLKRMVIVWSTGEESLRVLAFLVLSRVCRHKK 325


>BC060851-1|AAH60851.1|  742|Homo sapiens LOC401010 protein protein.
          Length = 742

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 15/34 (44%), Positives = 29/34 (85%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITRNQQ 614
           +M L++++++WST EE++RVLAFL + R+ R+++
Sbjct: 287 RMLLKRMVVVWSTGEESLRVLAFLVLSRVCRHKK 320


>BC003555-1|AAH03555.1|  749|Homo sapiens nucleolar complex
           associated 2 homolog (S. cerevisiae) protein.
          Length = 749

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 15/34 (44%), Positives = 29/34 (85%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITRNQQ 614
           +M L++++++WST EE++RVLAFL + R+ R+++
Sbjct: 292 RMLLKRMVVVWSTGEESLRVLAFLVLSRVCRHKK 325


>AK022756-1|BAB14230.1|  521|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12694 fis, clone NT2RP1000358, highly similar to
           Homo sapiens mRNA; cDNA DKFZp564C186 (from clone
           DKFZp564C186). ).
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 15/34 (44%), Positives = 29/34 (85%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITRNQQ 614
           +M L++++++WST EE++RVLAFL + R+ R+++
Sbjct: 59  RMLLKRMVVVWSTGEESLRVLAFLVLSRVCRHKK 92


>AL606467-2|CAI41431.1|  175|Homo sapiens chromosome X open reading
           frame 30 protein.
          Length = 175

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +1

Query: 196 FEPTQLGVQNCKVSFKSTLAVNLFNIKGIATEPKPQARTKLRLVDLQLLNLKMSSIHREC 375
           F P Q G   CK+  KS   V  + ++GI  E +P+A+ +      + L   +   ++  
Sbjct: 15  FLPLQSGRYPCKILLKSRYDVRAYYVEGIVNEEQPEAKFEFETPAFEALTQNIPIKNQTN 74

Query: 376 SKYT 387
            K+T
Sbjct: 75  DKWT 78


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,096,789
Number of Sequences: 237096
Number of extensions: 2038287
Number of successful extensions: 7030
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6932
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7028
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8567175942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -