SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY047505-1|AAK77237.1|  450|Drosophila melanogaster GH01524p pro...   126   3e-29
AE014296-1439|AAN12004.1|  416|Drosophila melanogaster CG7176-PF...   126   3e-29
AE014296-1438|AAN12003.1|  416|Drosophila melanogaster CG7176-PE...   126   3e-29
AE014296-1437|AAF50435.1|  416|Drosophila melanogaster CG7176-PA...   126   3e-29
AE014296-1436|AAN12002.1|  437|Drosophila melanogaster CG7176-PD...   126   3e-29
AE014296-1435|AAF50434.1|  469|Drosophila melanogaster CG7176-PC...   126   3e-29
AE014296-1434|AAO41266.1|  450|Drosophila melanogaster CG7176-PG...   126   3e-29
AE014296-1433|AAF50433.1|  450|Drosophila melanogaster CG7176-PB...   126   3e-29
AY058774-1|AAL14003.1|  693|Drosophila melanogaster SD05719p pro...    29   5.8  
AY052143-1|AAK93567.1|  942|Drosophila melanogaster SD10311p pro...    29   5.8  
AE014297-804|AAF54281.3|  942|Drosophila melanogaster CG8202-PA ...    29   5.8  
AE014134-3079|AAF53790.2|  693|Drosophila melanogaster CG17544-P...    29   5.8  
AE014134-3078|AAN11035.1|  693|Drosophila melanogaster CG17544-P...    29   5.8  
AE014134-3077|AAN11034.1|  693|Drosophila melanogaster CG17544-P...    29   5.8  

>AY047505-1|AAK77237.1|  450|Drosophila melanogaster GH01524p
           protein.
          Length = 450

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 49  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 108

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 109 TITPDEKRVEEFNLKKMWKSPNG 131



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 129 PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 186


>AE014296-1439|AAN12004.1|  416|Drosophila melanogaster CG7176-PF,
           isoform F protein.
          Length = 416

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 15  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 75  TITPDEKRVEEFNLKKMWKSPNG 97



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 95  PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 152


>AE014296-1438|AAN12003.1|  416|Drosophila melanogaster CG7176-PE,
           isoform E protein.
          Length = 416

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 15  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 75  TITPDEKRVEEFNLKKMWKSPNG 97



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 95  PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 152


>AE014296-1437|AAF50435.1|  416|Drosophila melanogaster CG7176-PA,
           isoform A protein.
          Length = 416

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 15  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 74

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 75  TITPDEKRVEEFNLKKMWKSPNG 97



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 95  PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 152


>AE014296-1436|AAN12002.1|  437|Drosophila melanogaster CG7176-PD,
           isoform D protein.
          Length = 437

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 36  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 95

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 96  TITPDEKRVEEFNLKKMWKSPNG 118



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 116 PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 173


>AE014296-1435|AAF50434.1|  469|Drosophila melanogaster CG7176-PC,
           isoform C protein.
          Length = 469

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 68  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 127

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 128 TITPDEKRVEEFNLKKMWKSPNG 150



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 148 PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 205


>AE014296-1434|AAO41266.1|  450|Drosophila melanogaster CG7176-PG,
           isoform G protein.
          Length = 450

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 49  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 108

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 109 TITPDEKRVEEFNLKKMWKSPNG 131



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 129 PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 186


>AE014296-1433|AAF50433.1|  450|Drosophila melanogaster CG7176-PB,
           isoform B protein.
          Length = 450

 Score =  126 bits (304), Expect = 3e-29
 Identities = 56/83 (67%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IK +LI P++ ++   +DLG+ +RD T+DQVTID A AI K+NVGIKCA
Sbjct: 49  GDEMTRIIWDSIKSQLILPFLDIELHTYDLGIENRDKTEDQVTIDCAEAIKKYNVGIKCA 108

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEF LKKMW SPNG
Sbjct: 109 TITPDEKRVEEFNLKKMWKSPNG 131



 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 49/58 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNILGGTVFRE I+C+++PR+V GW KPIVIGRHAH DQYKA D+VVP PGK+
Sbjct: 129 PNGTIRNILGGTVFREAIICKNVPRLVTGWQKPIVIGRHAHADQYKAVDYVVPGPGKL 186


>AY058774-1|AAL14003.1|  693|Drosophila melanogaster SD05719p
           protein.
          Length = 693

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 650 NKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEY 534
           N +    ++AVR +A   +F P RH     + +Y+  +Y
Sbjct: 317 NTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQY 355


>AY052143-1|AAK93567.1|  942|Drosophila melanogaster SD10311p
           protein.
          Length = 942

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 96  IHVITSSGEYTNNIETWLILVQQKF 170
           I+ +T   EY N +ETW + V Q F
Sbjct: 475 INKLTDPNEYINCVETWAVFVSQYF 499


>AE014297-804|AAF54281.3|  942|Drosophila melanogaster CG8202-PA
           protein.
          Length = 942

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 96  IHVITSSGEYTNNIETWLILVQQKF 170
           I+ +T   EY N +ETW + V Q F
Sbjct: 475 INKLTDPNEYINCVETWAVFVSQYF 499


>AE014134-3079|AAF53790.2|  693|Drosophila melanogaster CG17544-PC,
           isoform C protein.
          Length = 693

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 650 NKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEY 534
           N +    ++AVR +A   +F P RH     + +Y+  +Y
Sbjct: 317 NTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQY 355


>AE014134-3078|AAN11035.1|  693|Drosophila melanogaster CG17544-PB,
           isoform B protein.
          Length = 693

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 650 NKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEY 534
           N +    ++AVR +A   +F P RH     + +Y+  +Y
Sbjct: 317 NTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQY 355


>AE014134-3077|AAN11034.1|  693|Drosophila melanogaster CG17544-PA,
           isoform A protein.
          Length = 693

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 650 NKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEY 534
           N +    ++AVR +A   +F P RH     + +Y+  +Y
Sbjct: 317 NTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQY 355


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,163,678
Number of Sequences: 53049
Number of extensions: 623141
Number of successful extensions: 1491
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1445
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1491
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2930645700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -