SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.       153   3e-37
S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.       153   3e-37
X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.    152   4e-37
X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.    152   4e-37
BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p pro...   152   4e-37
AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p pro...   152   4e-37
AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-P...   152   4e-37
AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-P...   152   4e-37
AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-P...   152   4e-37
AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p pro...    99   2e-21
AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-P...    99   2e-21
BT003283-1|AAO25040.1|  178|Drosophila melanogaster HL05737p pro...    95   9e-20
BT001384-1|AAN71139.1|  178|Drosophila melanogaster GH03391p pro...    95   9e-20
AE014297-1707|AAS65146.1|  178|Drosophila melanogaster CG16901-P...    95   9e-20
S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognitio...    92   7e-19
X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.     86   3e-17
AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p pro...    86   3e-17
AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p pro...    86   3e-17
AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA...    86   3e-17
AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB...    86   3e-17
X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.     78   9e-15
DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneou...    78   9e-15
AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p pro...    78   9e-15
AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p pro...    78   9e-15
AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-P...    78   9e-15
AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-P...    78   9e-15
AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-P...    78   9e-15
X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.     76   4e-14
X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP pro...    76   4e-14
X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous ...    76   4e-14
X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.      76   4e-14
BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p pro...    76   4e-14
AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-P...    76   4e-14
AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-P...    76   4e-14
M25545-4|AAA28621.1|  361|Drosophila melanogaster protein ( D.me...    75   6e-14
M25545-3|AAA28624.1|  365|Drosophila melanogaster protein ( D.me...    75   6e-14
M25545-2|AAA28623.1|  360|Drosophila melanogaster protein ( D.me...    75   6e-14
M25545-1|AAA28622.1|  364|Drosophila melanogaster protein ( D.me...    75   6e-14
M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protei...    75   6e-14
AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p pro...    75   6e-14
AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF...    75   6e-14
AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD...    75   6e-14
AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC...    75   6e-14
AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB...    75   6e-14
AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE...    75   6e-14
AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA...    75   6e-14
U18401-1|AAC47508.1|  428|Drosophila melanogaster testis-specifi...    68   9e-12
AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p pro...    68   9e-12
AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA...    68   9e-12
S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognitio...    64   1e-10
L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprot...    64   1e-10
L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprot...    64   1e-10
BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p pro...    64   1e-10
AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE...    64   1e-10
AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD...    64   1e-10
AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI...    64   1e-10
AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH...    64   1e-10
AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF...    64   1e-10
AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB...    64   1e-10
AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG...    64   1e-10
AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC...    64   1e-10
AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA...    64   1e-10
BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p pro...    55   9e-08
AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p pro...    55   9e-08
AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-P...    55   9e-08
AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-P...    55   9e-08
AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-P...    55   9e-08
AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-P...    55   9e-08
AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding ...    55   9e-08
AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding ...    55   9e-08
AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding ...    55   9e-08
AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding ...    55   9e-08
AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding ...    55   9e-08
AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-P...    54   1e-07
AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-P...    54   1e-07
AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p pro...    52   5e-07
AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA...    52   5e-07
L13038-1|AAA02941.1|  465|Drosophila melanogaster polyadenylate-...    52   7e-07
L13037-1|AAA28828.1|  465|Drosophila melanogaster polyadenylate-...    52   7e-07
AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p pro...    52   7e-07
AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD...    52   7e-07
AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF...    52   7e-07
AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC...    52   7e-07
AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB...    52   7e-07
AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA ...    52   9e-07
U51858-1|AAC47133.1|  228|Drosophila melanogaster boule protein ...    51   1e-06
AE014296-1589|AAN11987.1|  189|Drosophila melanogaster CG4760-PC...    51   1e-06
AE014296-1588|AAF50316.3|  189|Drosophila melanogaster CG4760-PA...    51   1e-06
AE014296-1587|AAN11986.1|  228|Drosophila melanogaster CG4760-PD...    51   1e-06
AE014296-1586|AAF50317.3|  228|Drosophila melanogaster CG4760-PB...    51   1e-06
S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognitio...    50   3e-06
AY118842-1|AAM50702.1|  435|Drosophila melanogaster GM13065p pro...    50   3e-06
BT011495-1|AAR99153.1|   95|Drosophila melanogaster GH12029p pro...    49   5e-06
X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal p...    49   6e-06
BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p pro...    49   6e-06
BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p pro...    49   6e-06
AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p pro...    49   6e-06
AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint pr...    49   6e-06
AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U bindi...    49   6e-06
AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA ...    49   6e-06
AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD...    49   6e-06
AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC...    49   6e-06
AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB...    49   6e-06
AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA...    49   6e-06
AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p pro...    48   8e-06
AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-...    48   8e-06
AE014134-2808|AAF53587.1|  435|Drosophila melanogaster CG12288-P...    48   8e-06
AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA...    48   8e-06
BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p pro...    46   4e-05
AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p pro...    46   4e-05
AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p pro...    46   4e-05
AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-P...    46   4e-05
AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-P...    46   4e-05
AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-P...    46   4e-05
X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.       45   1e-04
M31162-1|AAA28859.1|  448|Drosophila melanogaster protein ( D.me...    45   1e-04
M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2 ...    45   1e-04
M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2 ...    45   1e-04
M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2 ...    45   1e-04
M23633-1|AAA28953.1|  264|Drosophila melanogaster protein ( D.me...    45   1e-04
J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2 ...    45   1e-04
BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p pro...    45   1e-04
BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p pro...    45   1e-04
AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p pro...    45   1e-04
AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p pro...    45   1e-04
AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p pro...    45   1e-04
AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p pro...    45   1e-04
AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage sti...    45   1e-04
AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA...    45   1e-04
AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA...    45   1e-04
AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA...    45   1e-04
AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-P...    45   1e-04
AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-P...    45   1e-04
AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-P...    45   1e-04
AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-P...    45   1e-04
AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-P...    45   1e-04
AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-P...    45   1e-04
X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.     44   2e-04
M59448-1|AAA28921.1|  366|Drosophila melanogaster Sxl protein.         44   2e-04
M59447-1|AAA28922.1|  354|Drosophila melanogaster Sx1 protein.         44   2e-04
M23636-1|AAA28884.1|  354|Drosophila melanogaster sex-linked pro...    44   2e-04
BT003583-1|AAO39587.1|  352|Drosophila melanogaster LD15933p pro...    44   2e-04
AE014298-1011|AAZ52512.1|  314|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1010|AAO41638.2|  314|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1009|AAF46241.3|  339|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1008|AAZ52511.1|  354|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1007|AAG22410.1|  354|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1006|AAN09198.1|  346|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1005|AAN09200.2|  346|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1004|AAZ52510.1|  344|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1003|AAN09197.1|  344|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1002|AAF46240.2|  366|Drosophila melanogaster CG18350-P...    44   2e-04
AE014298-1001|AAZ52509.1|  364|Drosophila melanogaster CG18350-P...    44   2e-04
AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-P...    44   2e-04
U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specifi...    44   2e-04
U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.       44   2e-04
AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p pro...    44   2e-04
AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-P...    44   2e-04
AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-P...    44   2e-04
AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-P...    44   2e-04
L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-bindin...    43   4e-04
AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p pro...    43   4e-04
AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p pro...    43   4e-04
AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p pro...    43   4e-04
AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA...    43   4e-04
AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA...    43   4e-04
AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH...    43   4e-04
AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG...    43   4e-04
AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF...    43   4e-04
AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE...    43   4e-04
AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD...    43   4e-04
AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC...    43   4e-04
AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB...    43   4e-04
AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA...    43   4e-04
BT029945-1|ABM92819.1|  657|Drosophila melanogaster IP16959p pro...    42   5e-04
BT023833-1|AAZ86754.1|  657|Drosophila melanogaster LD27920p pro...    42   5e-04
BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p pro...    42   5e-04
AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p pro...    42   5e-04
AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p pro...    42   5e-04
AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA...    42   5e-04
AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-P...    42   5e-04
AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-P...    42   5e-04
AE013599-3932|AAF47253.2|  657|Drosophila melanogaster CG4806-PA...    42   5e-04
S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognitio...    42   0.001
AY071005-1|AAL48627.1|  165|Drosophila melanogaster RE09075p pro...    42   0.001
L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding pr...    41   0.001
AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p pro...    41   0.001
AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p pro...    41   0.001
AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p pro...    41   0.001
AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-bind...    41   0.001
AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC...    41   0.001
AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA...    41   0.001
AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,...    41   0.001
AE013599-598|AAF59127.1|  224|Drosophila melanogaster CG2163-PA,...    41   0.001
AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p pro...    41   0.002
AE013599-786|AAF58987.1|  165|Drosophila melanogaster CG8781-PA ...    40   0.002
L23404-1|AAA03548.1|  416|Drosophila melanogaster RNA binding pr...    40   0.003
AY069320-1|AAL39465.1|  416|Drosophila melanogaster LD03714p pro...    40   0.003
AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA...    40   0.003
AE014298-2376|AAF48596.1|  416|Drosophila melanogaster CG9998-PA...    40   0.003
AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA...    40   0.003
BT001315-1|AAN71070.1|  617|Drosophila melanogaster AT14906p pro...    40   0.004
BT001292-1|AAN71048.1|  582|Drosophila melanogaster AT10134p pro...    40   0.004
AY052043-1|AAK93467.1|  704|Drosophila melanogaster LP05645p pro...    40   0.004
AE014297-3308|AAN13938.2|  559|Drosophila melanogaster CG10868-P...    40   0.004
AE014297-3307|AAN13937.1|  559|Drosophila melanogaster CG10868-P...    40   0.004
AE014297-3306|AAN13936.2|  913|Drosophila melanogaster CG10868-P...    40   0.004
AE014297-3305|AAN13935.1|  913|Drosophila melanogaster CG10868-P...    40   0.004
AE014297-3304|AAF56120.1|  915|Drosophila melanogaster CG10868-P...    40   0.004
AE014296-1543|AAF50352.1|  551|Drosophila melanogaster CG5735-PA...    40   0.004
AE014296-1542|AAN11975.1|  704|Drosophila melanogaster CG5735-PD...    40   0.004
AE014296-1541|AAF50351.1|  704|Drosophila melanogaster CG5735-PC...    40   0.004
AE014296-1540|AAF50350.1|  704|Drosophila melanogaster CG5735-PB...    40   0.004
AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p pro...    39   0.005
AY069434-1|AAL39579.1|  589|Drosophila melanogaster LD14125p pro...    39   0.005
AF173550-1|AAL29185.1|  165|Drosophila melanogaster Tsunagi prot...    39   0.005
AF145664-1|AAD38639.1|  793|Drosophila melanogaster BcDNA.GH1111...    39   0.005
AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA ...    39   0.005
AE013599-555|AAF59160.1|  793|Drosophila melanogaster CG2910-PB,...    39   0.005
AE013599-554|AAM68878.1|  793|Drosophila melanogaster CG2910-PA,...    39   0.005
AY094788-1|AAM11141.1| 1521|Drosophila melanogaster LD15253p pro...    39   0.007
AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends l...    39   0.007
AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP mot...    39   0.007
AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends p...    39   0.007
AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,...    39   0.007
AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,...    39   0.007
AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,...    39   0.007
AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p pro...    38   0.009
AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p pro...    38   0.009
AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family sp...    38   0.009
AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA...    38   0.009
AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB...    38   0.009
X64412-1|CAA45757.1|  915|Drosophila melanogaster ovarian protei...    38   0.011
BT003171-1|AAO24926.1|  443|Drosophila melanogaster SD07604p pro...    38   0.011
BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p pro...    38   0.011
BT001477-1|AAN71232.1|  443|Drosophila melanogaster LD21345p pro...    38   0.011
AY070578-1|AAL48049.1|  154|Drosophila melanogaster RE12122p pro...    38   0.011
AL023893-1|CAA19655.1|  485|Drosophila melanogaster EG:132E8.1 p...    38   0.011
AJ238969-1|CAB53185.1|  154|Drosophila melanogaster cap binding ...    38   0.011
AE014298-190|AAS65244.1|  443|Drosophila melanogaster CG3056-PB,...    38   0.011
AE014298-189|AAF45613.1|  485|Drosophila melanogaster CG3056-PA,...    38   0.011
AE014297-2442|AAF55496.1|  154|Drosophila melanogaster CG12357-P...    38   0.011
AE014296-817|AAF47879.2|  470|Drosophila melanogaster CG1316-PA ...    38   0.011
S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.        38   0.015
L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding pr...    38   0.015
L04930-1|AAC13645.1|  444|Drosophila melanogaster RNA-binding pr...    38   0.015
BT029936-1|ABM92810.1|  647|Drosophila melanogaster IP15810p pro...    38   0.015
BT011197-1|AAR88559.1|  439|Drosophila melanogaster GH26440p pro...    38   0.015
AY459767-1|AAS15953.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459766-1|AAS15952.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459765-1|AAS15951.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459764-1|AAS15950.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459763-1|AAS15949.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459762-1|AAS15948.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459761-1|AAS15947.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459760-1|AAS15946.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459759-1|AAS15945.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459758-1|AAS15944.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459757-1|AAS15943.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459756-1|AAS15942.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459755-1|AAS15941.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459754-1|AAS15940.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459753-1|AAS15939.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459752-1|AAS15938.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459751-1|AAS15937.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459750-1|AAS15936.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459749-1|AAS15935.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459748-1|AAS15934.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459747-1|AAS15933.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459746-1|AAS15932.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459745-1|AAS15931.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459744-1|AAS15930.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459743-1|AAS15929.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459742-1|AAS15928.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459741-1|AAS15927.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459740-1|AAS15926.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459739-1|AAS15925.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459738-1|AAS15924.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459737-1|AAS15923.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459736-1|AAS15922.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459735-1|AAS15921.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459734-1|AAS15920.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459733-1|AAS15919.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459732-1|AAS15918.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459731-1|AAS15917.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459730-1|AAS15916.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459729-1|AAS15915.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459728-1|AAS15914.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459727-1|AAS15913.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459726-1|AAS15912.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459725-1|AAS15911.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459724-1|AAS15910.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459723-1|AAS15909.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459722-1|AAS15908.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459721-1|AAS15907.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459720-1|AAS15906.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459719-1|AAS15905.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459718-1|AAS15904.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459717-1|AAS15903.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459716-1|AAS15902.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459715-1|AAS15901.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459714-1|AAS15900.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459713-1|AAS15899.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459712-1|AAS15898.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459711-1|AAS15897.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459710-1|AAS15896.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459709-1|AAS15895.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459708-1|AAS15894.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459707-1|AAS15893.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459706-1|AAS15892.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459705-1|AAS15891.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459704-1|AAS15890.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459703-1|AAS15889.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459702-1|AAS15888.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459701-1|AAS15887.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459700-1|AAS15886.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459699-1|AAS15885.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459698-1|AAS15884.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459697-1|AAS15883.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459696-1|AAS15882.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459695-1|AAS15881.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459694-1|AAS15880.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459693-1|AAS15879.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459692-1|AAS15878.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459691-1|AAS15877.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459690-1|AAS15876.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459689-1|AAS15875.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459688-1|AAS15874.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459687-1|AAS15873.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459686-1|AAS15872.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459685-1|AAS15871.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459684-1|AAS15870.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459683-1|AAS15869.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459682-1|AAS15868.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459681-1|AAS15867.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459680-1|AAS15866.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459679-1|AAS15865.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459678-1|AAS15864.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459677-1|AAS15863.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459676-1|AAS15862.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459675-1|AAS15861.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459674-1|AAS15860.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459673-1|AAS15859.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459672-1|AAS15858.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459671-1|AAS15857.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459670-1|AAS15856.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459669-1|AAS15855.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459668-1|AAS15854.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459667-1|AAS15853.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459666-1|AAS15852.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459665-1|AAS15851.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459664-1|AAS15850.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459663-1|AAS15849.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459662-1|AAS15848.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459661-1|AAS15847.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459660-1|AAS15846.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459659-1|AAS15845.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459658-1|AAS15844.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459657-1|AAS15843.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459656-1|AAS15842.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459655-1|AAS15841.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459654-1|AAS15840.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459653-1|AAS15839.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459652-1|AAS15838.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459651-1|AAS15837.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459650-1|AAS15836.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459649-1|AAS15835.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459648-1|AAS15834.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459647-1|AAS15833.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459646-1|AAS15832.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459645-1|AAS15831.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459644-1|AAS15830.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459643-1|AAS15829.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459642-1|AAS15828.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459641-1|AAS15827.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459640-1|AAS15826.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459639-1|AAS15825.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459638-1|AAS15824.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459637-1|AAS15823.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459636-1|AAS15822.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459635-1|AAS15821.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459634-1|AAS15820.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459633-1|AAS15819.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459632-1|AAS15818.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459631-1|AAS15817.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459630-1|AAS15816.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459629-1|AAS15815.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459628-1|AAS15814.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459627-1|AAS15813.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459626-1|AAS15812.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459625-1|AAS15811.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459624-1|AAS15810.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459623-1|AAS15809.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459622-1|AAS15808.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459621-1|AAS15807.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459620-1|AAS15806.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459619-1|AAS15805.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459618-1|AAS15804.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459617-1|AAS15803.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459616-1|AAS15802.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AY459615-1|AAS15801.1|   59|Drosophila melanogaster sex lethal p...    38   0.015
AE014134-520|AAX52651.1|  439|Drosophila melanogaster CG3151-PG,...    38   0.015
AE014134-519|AAN10403.1|  439|Drosophila melanogaster CG3151-PF,...    38   0.015
AE014134-518|AAN10402.1|  439|Drosophila melanogaster CG3151-PE,...    38   0.015
AE014134-517|AAF51178.2|  444|Drosophila melanogaster CG3151-PC,...    38   0.015
AE014134-516|AAF51177.2|  444|Drosophila melanogaster CG3151-PB,...    38   0.015
AE014134-515|AAN10401.2|  642|Drosophila melanogaster CG3151-PD,...    38   0.015
AE014134-514|AAF51179.3|  647|Drosophila melanogaster CG3151-PA,...    38   0.015
AY118847-1|AAM50707.1|  181|Drosophila melanogaster GM15173p pro...    37   0.020
AY071650-1|AAL49272.1|  361|Drosophila melanogaster RE72594p pro...    37   0.020
AY060253-1|AAL25292.1|  238|Drosophila melanogaster GH07919p pro...    37   0.020
AE014134-2184|AAN10813.1|  361|Drosophila melanogaster CG31762-P...    37   0.020
AY089603-1|AAL90341.1|  121|Drosophila melanogaster RE19804p pro...    37   0.026
AY061107-1|AAL28655.1|  595|Drosophila melanogaster LD09531p pro...    37   0.026
AF219009-1|AAF27644.1|  595|Drosophila melanogaster multi-sex-co...    37   0.026
AE014298-1312|AAF46473.1|  595|Drosophila melanogaster CG12058-P...    37   0.026
AE014296-1096|AAF50675.1|  121|Drosophila melanogaster CG13298-P...    37   0.026
AE013599-3954|AAF47270.1|  250|Drosophila melanogaster CG3594-PA...    36   0.035
X55902-1|CAA39395.1|  700|Drosophila melanogaster Bj6 protein pr...    36   0.046
M33496-2|AAA03215.1|  698|Drosophila melanogaster protein ( D.me...    36   0.046
M33496-1|AAA03214.1|  700|Drosophila melanogaster protein ( D.me...    36   0.046
AY119651-1|AAM50305.1|  700|Drosophila melanogaster RE58280p pro...    36   0.046
AE014298-2380|AAX52501.1|  698|Drosophila melanogaster CG4211-PC...    36   0.046
AE014298-2379|AAF48597.2|  700|Drosophila melanogaster CG4211-PA...    36   0.046
AE014298-2378|AAN09398.1|  742|Drosophila melanogaster CG4211-PB...    36   0.046
AY069464-1|AAL39609.1|  632|Drosophila melanogaster LD19052p pro...    36   0.061
AY060398-1|AAL25437.1|  422|Drosophila melanogaster LD31834p pro...    36   0.061
AY058563-1|AAL13792.1|  652|Drosophila melanogaster LD25239p pro...    36   0.061
AE014296-2305|AAF49798.2|  422|Drosophila melanogaster CG12478-P...    36   0.061
AE014296-1420|AAF50445.2|  652|Drosophila melanogaster CG7185-PA...    36   0.061
AE014134-2189|AAF53180.3|  632|Drosophila melanogaster CG31761-P...    36   0.061
AE014134-2188|AAF53181.2|  632|Drosophila melanogaster CG31761-P...    36   0.061
AE014134-2187|AAO41184.1|  737|Drosophila melanogaster CG31761-P...    36   0.061
AE014134-2186|ABI31310.1|  893|Drosophila melanogaster CG31761-P...    36   0.061
U31961-18|AAA84417.1|  642|Drosophila melanogaster protein ( Dro...    35   0.080
AY119141-1|AAM51001.1|  411|Drosophila melanogaster RE44625p pro...    35   0.080
AY118927-1|AAM50787.1|  374|Drosophila melanogaster LD23870p pro...    35   0.080
AJ459409-1|CAD30680.1|  374|Drosophila melanogaster RNA-binding ...    35   0.080
AE014297-2248|AAF55347.1|  630|Drosophila melanogaster CG10328-P...    35   0.080
AE014297-964|AAF54396.2|  374|Drosophila melanogaster CG16788-PA...    35   0.080
BT003653-1|AAO39657.1|  626|Drosophila melanogaster AT01548p pro...    35   0.11 
AF132148-1|AAD34736.1|  653|Drosophila melanogaster unknown prot...    35   0.11 
AE014297-3634|AAF56342.1|  653|Drosophila melanogaster CG5808-PA...    35   0.11 
AE014297-2864|AAN13834.1|  529|Drosophila melanogaster CG17838-P...    35   0.11 
AE014297-2863|AAN13833.1|  529|Drosophila melanogaster CG17838-P...    35   0.11 
AE014297-2862|AAF55805.2|  707|Drosophila melanogaster CG17838-P...    35   0.11 
AE014297-2861|AAN13831.1|  571|Drosophila melanogaster CG17838-P...    35   0.11 
AE014297-2858|AAN13832.2|  563|Drosophila melanogaster CG17838-P...    35   0.11 
S51738-1|AAB24630.1|   44|Drosophila melanogaster RNA recognitio...    34   0.14 
BT011006-1|AAR27877.1|  690|Drosophila melanogaster AT27578p pro...    34   0.14 
AY095057-1|AAM11385.1|  258|Drosophila melanogaster LD46359p pro...    34   0.14 
AY061516-1|AAL29064.1|  418|Drosophila melanogaster LD46870p pro...    34   0.14 
AY058617-1|AAL13846.1|  690|Drosophila melanogaster LD31194p pro...    34   0.14 
AJ249466-1|CAB60724.1|  258|Drosophila melanogaster DXl6 protein...    34   0.14 
AF232774-1|AAF43414.1|  258|Drosophila melanogaster SR family sp...    34   0.14 
AF231031-1|AAF68949.1|  690|Drosophila melanogaster rasputin pro...    34   0.14 
AE014297-1713|AAN13573.1|  690|Drosophila melanogaster CG9412-PE...    34   0.14 
AE014297-1712|AAN13572.1|  690|Drosophila melanogaster CG9412-PD...    34   0.14 
AE014297-1711|AAN13571.1|  690|Drosophila melanogaster CG9412-PC...    34   0.14 
AE014297-1710|AAG22151.2|  690|Drosophila melanogaster CG9412-PB...    34   0.14 
AE014297-1709|AAF54965.3|  690|Drosophila melanogaster CG9412-PA...    34   0.14 
AE014297-952|AAF54387.1|  632|Drosophila melanogaster CG9373-PA ...    34   0.14 
AE014297-14|AAF52166.2|  418|Drosophila melanogaster CG14641-PA ...    34   0.14 
AE014134-1188|AAF52454.1|  258|Drosophila melanogaster CG10203-P...    34   0.14 
L23873-1|AAA28862.1|   48|Drosophila melanogaster Rox2 protein.        34   0.19 
BT029153-1|ABJ17088.1|  708|Drosophila melanogaster SD01194p pro...    34   0.19 
BT028873-1|ABI34254.1|  708|Drosophila melanogaster SD20656p pro...    34   0.19 
AE014298-2037|AAF48376.4|  205|Drosophila melanogaster CG14414-P...    34   0.19 
AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA...    34   0.19 
L34935-1|AAA73521.1|  197|Drosophila melanogaster RNA binding pr...    33   0.25 
AY071363-1|AAL48985.1|  200|Drosophila melanogaster RE39606p pro...    33   0.25 
AY058477-1|AAL13706.1|  529|Drosophila melanogaster GH28335p pro...    33   0.25 
AE014297-2865|AAN13835.1|  529|Drosophila melanogaster CG17838-P...    33   0.25 
AE014134-1804|AAF52890.1|  200|Drosophila melanogaster CG5655-PA...    33   0.25 
BT024190-1|ABC86252.1|  358|Drosophila melanogaster RH12113p pro...    33   0.32 
AE014298-2413|AAN09409.1|  324|Drosophila melanogaster CG4429-PB...    33   0.32 
AE014298-2412|AAF48616.1|  325|Drosophila melanogaster CG4429-PA...    33   0.32 
AE014298-2411|AAS65388.1|  358|Drosophila melanogaster CG4429-PC...    33   0.32 
M21152-1|AAA28506.1|  483|Drosophila melanogaster elav protein.        33   0.43 
AY060995-1|AAL28543.1|  322|Drosophila melanogaster HL01227p pro...    33   0.43 
AY051822-1|AAK93246.1|  483|Drosophila melanogaster LD33076p pro...    33   0.43 
AL022139-2|CAB37430.1|  483|Drosophila melanogaster EG:65F1.2,FB...    33   0.43 
AL022139-1|CAA18091.1|  479|Drosophila melanogaster EG:65F1.2,FB...    33   0.43 
AE014298-54|AAX52472.1|  479|Drosophila melanogaster CG4262-PB, ...    33   0.43 
AE014298-53|AAF45517.2|  483|Drosophila melanogaster CG4262-PA, ...    33   0.43 
AE014296-939|AAN12240.1|  499|Drosophila melanogaster CG32423-PD...    33   0.43 
AE014296-938|AAF50790.2|  499|Drosophila melanogaster CG32423-PB...    33   0.43 
BT023584-1|AAY84984.1|  291|Drosophila melanogaster IP09423p pro...    32   0.57 
AE014296-1944|AAF50069.1|  291|Drosophila melanogaster CG11726-P...    32   0.57 
BT015266-1|AAT94495.1|  459|Drosophila melanogaster LD33831p pro...    32   0.75 
AY071474-1|AAL49096.1|  390|Drosophila melanogaster RE54950p pro...    32   0.75 
AY051919-1|AAK93343.1|  255|Drosophila melanogaster LD40489p pro...    31   0.99 
AF234157-1|AAF60294.1|  255|Drosophila melanogaster SR family sp...    31   0.99 
AF232773-1|AAF43413.1|  255|Drosophila melanogaster SR family sp...    31   0.99 
AE014297-2188|AAF55300.1|  255|Drosophila melanogaster CG6987-PA...    31   0.99 

>S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.
          Length = 308

 Score =  153 bits (370), Expect = 3e-37
 Identities = 79/145 (54%), Positives = 97/145 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTKE 369
            EH IN+KKVDPKKAKARHGKI       +    + +T         +   PL KQ+++ 
Sbjct: 117 DEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQR 176

Query: 370 RASVSSHLNLSKL*MICLRLPKEQL 444
           +       +  ++    L+ PK+++
Sbjct: 177 KGFCFITFDSEQVVTDLLKTPKQKI 201



 Score =  134 bits (324), Expect = 9e-32
 Identities = 61/89 (68%), Positives = 75/89 (84%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMP DK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.
          Length = 321

 Score =  153 bits (370), Expect = 3e-37
 Identities = 79/145 (54%), Positives = 97/145 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTKE 369
            EH IN+KKVDPKKAKARHGKI       +    + +T         +   PL KQ+++ 
Sbjct: 117 DEHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQR 176

Query: 370 RASVSSHLNLSKL*MICLRLPKEQL 444
           +       +  ++    L+ PK+++
Sbjct: 177 KGFCFITFDSEQVVTDLLKTPKQKI 201



 Score =  134 bits (324), Expect = 9e-32
 Identities = 61/89 (68%), Positives = 75/89 (84%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMP DK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.
          Length = 345

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.
          Length = 321

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p
           protein.
          Length = 308

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p
           protein.
          Length = 321

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-PA,
           isoform A protein.
          Length = 321

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-PB,
           isoform B protein.
          Length = 344

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-PC,
           isoform C protein.
          Length = 308

 Score =  152 bits (368), Expect = 4e-37
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 2e-32
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p
           protein.
          Length = 369

 Score =   99 bits (238), Expect = 2e-21
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ + LRD+FG YG+I    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 30  KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQ 89

Query: 190 GEHTINNKKVDPKKAKAR--HGKILSEDSAV 276
           G H ++ KKVDPK A  R  H K+++    +
Sbjct: 90  GTHELDGKKVDPKVAFPRRAHPKMVTRTKKI 120



 Score = 72.1 bits (169), Expect = 6e-13
 Identities = 34/81 (41%), Positives = 51/81 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G IE   +  D  T R RGF F+ F++ + +DKV
Sbjct: 116 RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 176 CEIHFHEINNKMVECKKAQPK 196



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 30/76 (39%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+  + ++++++F +FG I +  + FDK  N+ +GF F+TF+SE VV+ + +   
Sbjct: 121 FVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHF 180

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 181 HEINNKMVECKKAQPK 196



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 28/80 (35%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S + +R++F  +G I E  +  D T  + +GF F+TF     V+ +L    
Sbjct: 32  FIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGT 91

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK+VD K A P+   P
Sbjct: 92  HELDGKKVDPKVAFPRRAHP 111


>AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-PA
           protein.
          Length = 369

 Score =   99 bits (238), Expect = 2e-21
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ + LRD+FG YG+I    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 30  KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQ 89

Query: 190 GEHTINNKKVDPKKAKAR--HGKILSEDSAV 276
           G H ++ KKVDPK A  R  H K+++    +
Sbjct: 90  GTHELDGKKVDPKVAFPRRAHPKMVTRTKKI 120



 Score = 72.1 bits (169), Expect = 6e-13
 Identities = 34/81 (41%), Positives = 51/81 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G IE   +  D  T R RGF F+ F++ + +DKV
Sbjct: 116 RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 176 CEIHFHEINNKMVECKKAQPK 196



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 30/76 (39%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+  + ++++++F +FG I +  + FDK  N+ +GF F+TF+SE VV+ + +   
Sbjct: 121 FVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHF 180

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 181 HEINNKMVECKKAQPK 196



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 28/80 (35%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S + +R++F  +G I E  +  D T  + +GF F+TF     V+ +L    
Sbjct: 32  FIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGT 91

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK+VD K A P+   P
Sbjct: 92  HELDGKKVDPKVAFPRRAHP 111


>BT003283-1|AAO25040.1|  178|Drosophila melanogaster HL05737p
           protein.
          Length = 178

 Score = 94.7 bits (225), Expect = 9e-20
 Identities = 42/50 (84%), Positives = 46/50 (92%)
 Frame = +3

Query: 339 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           MPFDK K+QRKGFCFITF+SEQVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 1   MPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>BT001384-1|AAN71139.1|  178|Drosophila melanogaster GH03391p
           protein.
          Length = 178

 Score = 94.7 bits (225), Expect = 9e-20
 Identities = 42/50 (84%), Positives = 46/50 (92%)
 Frame = +3

Query: 339 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           MPFDK K+QRKGFCFITF+SEQVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 1   MPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>AE014297-1707|AAS65146.1|  178|Drosophila melanogaster CG16901-PD,
           isoform D protein.
          Length = 178

 Score = 94.7 bits (225), Expect = 9e-20
 Identities = 42/50 (84%), Positives = 46/50 (92%)
 Frame = +3

Query: 339 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           MPFDK K+QRKGFCFITF+SEQVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 1   MPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 91.9 bits (218), Expect = 7e-19
 Identities = 40/44 (90%), Positives = 42/44 (95%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           FVGGLSWETT+KELRDHFG YGEIE+INVKTDP TGRSRGFAFI
Sbjct: 1   FVGGLSWETTEKELRDHFGKYGEIENINVKTDPQTGRSRGFAFI 44



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI
Sbjct: 1   FVGGLSWETTEKELRDHFGKYGEIENINVKTDPQTGRSRGFAFI 44


>X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.
          Length = 606

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 176 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 235

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 236 PIHTLDGKKIDPKHATPKN 254



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 249 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 307

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 308 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 341



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 178 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 237

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 238 HTLDGKKIDPKHATPK 253



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 263 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 322

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 323 IHFHTIKNKKVECKKAQPK 341


>AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p
           protein.
          Length = 634

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 263

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 264 PIHTLDGKKIDPKHATPKN 282



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 277 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 335

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 336 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 369



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 206 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 265

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 266 HTLDGKKIDPKHATPK 281



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 291 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 350

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 351 IHFHTIKNKKVECKKAQPK 369


>AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p
           protein.
          Length = 606

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 176 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 235

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 236 PIHTLDGKKIDPKHATPKN 254



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 249 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 307

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 308 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 341



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 178 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 237

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 238 HTLDGKKIDPKHATPK 253



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 263 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 322

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 323 IHFHTIKNKKVECKKAQPK 341


>AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA,
           isoform A protein.
          Length = 606

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 176 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 235

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 236 PIHTLDGKKIDPKHATPKN 254



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 249 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 307

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 308 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 341



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 178 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 237

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 238 HTLDGKKIDPKHATPK 253



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 263 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 322

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 323 IHFHTIKNKKVECKKAQPK 341


>AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB,
           isoform B protein.
          Length = 634

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 263

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 264 PIHTLDGKKIDPKHATPKN 282



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 277 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 335

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 336 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 369



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 206 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 265

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 266 HTLDGKKIDPKHATPK 281



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 291 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 350

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 351 IHFHTIKNKKVECKKAQPK 369


>X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.
          Length = 385

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p
           protein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p
           protein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-PC,
           isoform C protein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-PB,
           isoform B protein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-PA,
           isoform A protein.
          Length = 421

 Score = 78.2 bits (184), Expect = 9e-15
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.
          Length = 326

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP
           protein) protein.
          Length = 386

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 386

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.
          Length = 386

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p
           protein.
          Length = 385

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-PA,
           isoform A protein.
          Length = 385

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-PB,
           isoform B protein.
          Length = 325

 Score = 76.2 bits (179), Expect = 4e-14
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>M25545-4|AAA28621.1|  361|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 361

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 88  RPHKIDGRVVEPKRAVPR 105



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 118 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 177

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 178 QKQHQLNGKMVDVKKA 193



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 105 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 163

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 164 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 30  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 89

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 90  HKIDGRVVEPKRAVPRQD 107


>M25545-3|AAA28624.1|  365|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 365

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 92  RPHKIDGRVVEPKRAVPR 109



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 122 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 181

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 182 QKQHQLNGKMVDVKKA 197



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 109 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 167

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 168 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 34  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 93

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 94  HKIDGRVVEPKRAVPRQD 111


>M25545-2|AAA28623.1|  360|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 360

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 27  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 86

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 87  RPHKIDGRVVEPKRAVPR 104



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 117 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 176

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 177 QKQHQLNGKMVDVKKA 192



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 104 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 162

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 163 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 195



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 29  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 88

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 89  HKIDGRVVEPKRAVPRQD 106


>M25545-1|AAA28622.1|  364|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 364

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 31  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 90

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 91  RPHKIDGRVVEPKRAVPR 108



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 121 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 180

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 181 QKQHQLNGKMVDVKKA 196



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 108 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 166

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 167 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 199



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 33  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 92

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 93  HKIDGRVVEPKRAVPRQD 110


>M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protein
           protein.
          Length = 365

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 92  RPHKIDGRVVEPKRAVPR 109



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 122 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 181

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 182 QKQHQLNGKMVDVKKA 197



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 109 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 167

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 168 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 34  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 93

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 94  HKIDGRVVEPKRAVPRQD 111


>AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p
           protein.
          Length = 361

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 88  RPHKIDGRVVEPKRAVPR 105



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 118 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 177

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 178 QKQHQLNGKMVDVKKA 193



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 105 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 163

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 164 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 30  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 89

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 90  HKIDGRVVEPKRAVPRQD 107


>AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF,
           isoform F protein.
          Length = 361

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 88  RPHKIDGRVVEPKRAVPR 105



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 118 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 177

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 178 QKQHQLNGKMVDVKKA 193



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 105 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 163

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 164 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 30  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 89

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 90  HKIDGRVVEPKRAVPRQD 107


>AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD,
           isoform D protein.
          Length = 361

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 88  RPHKIDGRVVEPKRAVPR 105



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 118 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 177

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 178 QKQHQLNGKMVDVKKA 193



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 105 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 163

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 164 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 30  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 89

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 90  HKIDGRVVEPKRAVPRQD 107


>AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC,
           isoform C protein.
          Length = 365

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 92  RPHKIDGRVVEPKRAVPR 109



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 122 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 181

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 182 QKQHQLNGKMVDVKKA 197



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 109 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 167

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 168 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 34  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 93

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 94  HKIDGRVVEPKRAVPRQD 111


>AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB,
           isoform B protein.
          Length = 365

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 92  RPHKIDGRVVEPKRAVPR 109



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 122 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 181

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 182 QKQHQLNGKMVDVKKA 197



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 109 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 167

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 168 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 34  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 93

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 94  HKIDGRVVEPKRAVPRQD 111


>AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE,
           isoform E protein.
          Length = 360

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 27  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 86

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 87  RPHKIDGRVVEPKRAVPR 104



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 117 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 176

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 177 QKQHQLNGKMVDVKKA 192



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 104 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 162

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 163 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 195



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 29  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 88

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 89  HKIDGRVVEPKRAVPRQD 106


>AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA,
           isoform A protein.
          Length = 364

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD+ L+ HF  +G I  + V  DP T RSRGF FI +     ID+   +
Sbjct: 31  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 90

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 91  RPHKIDGRVVEPKRAVPR 108



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L  +  ++ +RD+F  +G I  IN+  D  TG+ RGFAF+ F   + +DKV+ 
Sbjct: 121 KKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVL 180

Query: 187 AGEHTINNKKVDPKKA 234
             +H +N K VD KKA
Sbjct: 181 QKQHQLNGKMVDVKKA 196



 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 30/93 (32%), Positives = 52/93 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q    P  G +T  + FVG L  +  +  IR++F  FG I+++ +  DK   +++GF F
Sbjct: 108 RQDIDSPNAG-ATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAF 166

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + F+    V+ ++   +  + GK VDVK+A PK
Sbjct: 167 VEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 199



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +D+ ++  F ++G I++V +  D    + +GF FIT+    ++++  K+  
Sbjct: 33  FIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP 92

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 93  HKIDGRVVEPKRAVPRQD 110


>U18401-1|AAC47508.1|  428|Drosophila melanogaster
           testis-specific-RRM-protein protein.
          Length = 428

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS +TT + LR  F  +G +    V  DP +  SRGF F+ +  P+S++ V  A
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             HTI+NK V+ K A  R
Sbjct: 93  RPHTIDNKIVETKHALPR 110



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS++ + + +R FFS+FG + +  +  D   N  +GF F+T+   + V  + +   
Sbjct: 35  FIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI  K V+ K A P+ D
Sbjct: 95  HTIDNKIVETKHALPRQD 112



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++F+GGL     +  +R++F  +G + S+ +  D  TGR R F F+ F  P S +K +A
Sbjct: 136 KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    V+ K++
Sbjct: 196 PRKHWILQTLVEVKRS 211



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL     ++ +R +FS+FG +  V++  D+   +++ F F+ F         L   K
Sbjct: 139 FLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198

Query: 435 RTIGGKEVDVKRATPKPD 488
             I    V+VKR+T K D
Sbjct: 199 HWILQTLVEVKRSTQKAD 216


>AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p
           protein.
          Length = 428

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS +TT + LR  F  +G +    V  DP +  SRGF F+ +  P+S++ V  A
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             HTI+NK V+ K A  R
Sbjct: 93  RPHTIDNKIVETKHALPR 110



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS++ + + +R FFS+FG + +  +  D   N  +GF F+T+   + V  + +   
Sbjct: 35  FIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI  K V+ K A P+ D
Sbjct: 95  HTIDNKIVETKHALPRQD 112



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++F+GGL     +  +R++F  +G + S+ +  D  TGR R F F+ F  P S +K +A
Sbjct: 136 KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    V+ K++
Sbjct: 196 PRKHWILQTLVEVKRS 211



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL     ++ +R +FS+FG +  V++  D+   +++ F F+ F         L   K
Sbjct: 139 FLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198

Query: 435 RTIGGKEVDVKRATPKPD 488
             I    V+VKR+T K D
Sbjct: 199 HWILQTLVEVKRSTQKAD 216


>AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA
           protein.
          Length = 428

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS +TT + LR  F  +G +    V  DP +  SRGF F+ +  P+S++ V  A
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             HTI+NK V+ K A  R
Sbjct: 93  RPHTIDNKIVETKHALPR 110



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS++ + + +R FFS+FG + +  +  D   N  +GF F+T+   + V  + +   
Sbjct: 35  FIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI  K V+ K A P+ D
Sbjct: 95  HTIDNKIVETKHALPRQD 112



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++F+GGL     +  +R++F  +G + S+ +  D  TGR R F F+ F  P S +K +A
Sbjct: 136 KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    V+ K++
Sbjct: 196 PRKHWILQTLVEVKRS 211



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL     ++ +R +FS+FG +  V++  D+   +++ F F+ F         L   K
Sbjct: 139 FLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198

Query: 435 RTIGGKEVDVKRATPKPD 488
             I    V+VKR+T K D
Sbjct: 199 HWILQTLVEVKRSTQKAD 216


>S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 27/44 (61%), Positives = 33/44 (75%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           FVGGLSW+T+ + LRD+FG YG+I    V  DP T RSRGFAF+
Sbjct: 1   FVGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFAFV 44



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           FVGGLS + S + +R++F  +G I E  +  D T  + +GF F+
Sbjct: 1   FVGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFAFV 44


>L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 465

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 471

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p
           protein.
          Length = 434

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE,
           isoform E protein.
          Length = 434

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD,
           isoform D protein.
          Length = 434

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI,
           isoform I protein.
          Length = 471

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH,
           isoform H protein.
          Length = 471

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF,
           isoform F protein.
          Length = 471

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB,
           isoform B protein.
          Length = 471

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG,
           isoform G protein.
          Length = 465

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC,
           isoform C protein.
          Length = 465

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA,
           isoform A protein.
          Length = 465

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p
           protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p
           protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-PA,
           isoform A protein.
          Length = 332

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-PD,
           isoform D protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-PC,
           isoform C protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-PB,
           isoform B protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT++ LR++F  YGE+    +K D  +G+S+GF F+ F + ++  +V+   
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL-TN 167

Query: 193 EHTINNKKVDPK 228
            H I+ +  + K
Sbjct: 168 RHLIDGRWCEVK 179



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I+ D++R +FS+FG + +V +P        + F F+TF    V   L     
Sbjct: 195 FVGRCTEDINSDDLREYFSKFGEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLC-GED 248

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V V  A PK +
Sbjct: 249 HIIKGVSVHVSNAAPKAE 266



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 18/75 (24%), Positives = 35/75 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P+ + + +  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRP-----FRAFSFVTFLDPD-VAQSLCG 246

Query: 190 GEHTINNKKVDPKKA 234
            +H I    V    A
Sbjct: 247 EDHIIKGVSVHVSNA 261


>AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-PB,
           isoform B protein.
          Length = 90

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/75 (30%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVG L W    +ELR +F  +G + S NV  D  TG S+G+ F+ F +  +++K+   
Sbjct: 16  RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

Query: 190 GEHTINNKKVDPKKA 234
            +H +    ++ +K+
Sbjct: 76  QKHILEGNYLNIQKS 90



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L   +   E+R +F EFG ++   + FDK     KG+ F++F S   +  +    K
Sbjct: 18  FVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQK 77

Query: 435 RTIGGKEVDVKRA 473
             + G  ++++++
Sbjct: 78  HILEGNYLNIQKS 90


>AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-PA,
           isoform A protein.
          Length = 90

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/75 (30%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVG L W    +ELR +F  +G + S NV  D  TG S+G+ F+ F +  +++K+   
Sbjct: 16  RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

Query: 190 GEHTINNKKVDPKKA 234
            +H +    ++ +K+
Sbjct: 76  QKHILEGNYLNIQKS 90



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L   +   E+R +F EFG ++   + FDK     KG+ F++F S   +  +    K
Sbjct: 18  FVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQK 77

Query: 435 RTIGGKEVDVKRA 473
             + G  ++++++
Sbjct: 78  HILEGNYLNIQKS 90


>AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p
           protein.
          Length = 318

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 24/77 (31%), Positives = 46/77 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS+ TT+++LR++F  YG++    +K D  +G S+GF F+ F + + +   + + 
Sbjct: 109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD-VQMHVLSK 167

Query: 193 EHTINNKKVDPKKAKAR 243
            H+I+ +  + K   +R
Sbjct: 168 RHSIDGRWCEVKVPASR 184



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GLS   ++ ++R +F  +G +++ E+  D      KGF F+ F S  V   +L + + +I
Sbjct: 113 GLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVL-SKRHSI 171

Query: 444 GGKEVDVK 467
            G+  +VK
Sbjct: 172 DGRWCEVK 179



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 24/76 (31%), Positives = 39/76 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I  D++R +FS+FG +++V +P        + F F+TF  +  V  ++   K
Sbjct: 195 FVGRCTEDIEADDLREYFSKFGEVIDVFIP-----KPFRAFSFVTF-LDPYVPRVVCGEK 248

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V V  A  K
Sbjct: 249 HIIKGVSVHVSTADKK 264



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P  + +V+  
Sbjct: 193 KVFVGRCTEDIEADDLREYFSKFGEVIDVFIPKP-----FRAFSFVTFLDP-YVPRVVCG 246

Query: 190 GEHTINNKKVDPKKAKARH 246
            +H I    V    A  ++
Sbjct: 247 EKHIIKGVSVHVSTADKKN 265


>AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA
           protein.
          Length = 318

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 24/77 (31%), Positives = 46/77 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS+ TT+++LR++F  YG++    +K D  +G S+GF F+ F + + +   + + 
Sbjct: 109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD-VQMHVLSK 167

Query: 193 EHTINNKKVDPKKAKAR 243
            H+I+ +  + K   +R
Sbjct: 168 RHSIDGRWCEVKVPASR 184



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GLS   ++ ++R +F  +G +++ E+  D      KGF F+ F S  V   +L + + +I
Sbjct: 113 GLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVL-SKRHSI 171

Query: 444 GGKEVDVK 467
            G+  +VK
Sbjct: 172 DGRWCEVK 179



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 24/76 (31%), Positives = 39/76 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +I  D++R +FS+FG +++V +P        + F F+TF  +  V  ++   K
Sbjct: 195 FVGRCTEDIEADDLREYFSKFGEVIDVFIP-----KPFRAFSFVTF-LDPYVPRVVCGEK 248

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V V  A  K
Sbjct: 249 HIIKGVSVHVSTADKK 264



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG  + +    +LR++F  +GE+  + +         R F+F+ F  P  + +V+  
Sbjct: 193 KVFVGRCTEDIEADDLREYFSKFGEVIDVFIPKP-----FRAFSFVTFLDP-YVPRVVCG 246

Query: 190 GEHTINNKKVDPKKAKARH 246
            +H I    V    A  ++
Sbjct: 247 EKHIIKGVSVHVSTADKKN 265


>L13038-1|AAA02941.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNRQWIASRSI 166



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +    ++ I  + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNRQWIASRSIRTNWSTRKLPPP 178


>L13037-1|AAA28828.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNRQWIASRSI 166



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +    ++ I  + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNRQWIASRSIRTNWSTRKLPPP 178


>AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p
           protein.
          Length = 470

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD,
           isoform D protein.
          Length = 470

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF,
           isoform F protein.
          Length = 464

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC,
           isoform C protein.
          Length = 464

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB,
           isoform B protein.
          Length = 464

 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA
           protein.
          Length = 91

 Score = 51.6 bits (118), Expect = 9e-07
 Identities = 23/75 (30%), Positives = 38/75 (50%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG L W    KELR +F  YG + +  V  D   G S+ + F+VF   ++ +     
Sbjct: 11  KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQ 70

Query: 190 GEHTINNKKVDPKKA 234
             H ++ + +  ++A
Sbjct: 71  NTHFLDGRVLTVQRA 85



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/82 (26%), Positives = 39/82 (47%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           ++++ FVG L   I   E+R +FS++G +   E+ FD+     K + F+ F      N  
Sbjct: 8   SSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSA 67

Query: 420 LKTPKRTIGGKEVDVKRATPKP 485
                  + G+ + V+RA   P
Sbjct: 68  SNQNTHFLDGRVLTVQRANESP 89


>U51858-1|AAC47133.1|  228|Drosophila melanogaster boule protein
           protein.
          Length = 228

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 GE 195
           GE
Sbjct: 93  GE 94



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>AE014296-1589|AAN11987.1|  189|Drosophila melanogaster CG4760-PC,
           isoform C protein.
          Length = 189

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 GE 195
           GE
Sbjct: 93  GE 94



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>AE014296-1588|AAF50316.3|  189|Drosophila melanogaster CG4760-PA,
           isoform A protein.
          Length = 189

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 GE 195
           GE
Sbjct: 93  GE 94



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>AE014296-1587|AAN11986.1|  228|Drosophila melanogaster CG4760-PD,
           isoform D protein.
          Length = 228

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 GE 195
           GE
Sbjct: 93  GE 94



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>AE014296-1586|AAF50317.3|  228|Drosophila melanogaster CG4760-PB,
           isoform B protein.
          Length = 228

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 GE 195
           GE
Sbjct: 93  GE 94



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/44 (50%), Positives = 29/44 (65%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           FVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+
Sbjct: 1   FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFV 44



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+
Sbjct: 1   FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFV 44


>AY118842-1|AAM50702.1|  435|Drosophila melanogaster GM13065p
           protein.
          Length = 435

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 33/126 (26%), Positives = 68/126 (53%), Gaps = 3/126 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG L +  T+++LR+ F + GEI+ I    D + G  +G A++ F+ P+++   +   
Sbjct: 262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALELN 320

Query: 193 EHTINNKKVDPKKAKARH-GKILSEDSAVKSQMMK--SETSSVNLELS*KWRCPLTKQRT 363
           +  ++++ ++ ++ + +  G     D+A  S   K  S+T + N + S   +  L K++ 
Sbjct: 321 QTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKN-QNSAGAKKRLDKKKG 379

Query: 364 KERASV 381
           KE  SV
Sbjct: 380 KENGSV 385


>BT011495-1|AAR99153.1|   95|Drosophila melanogaster GH12029p
           protein.
          Length = 95

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 21/61 (34%), Positives = 37/61 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+S +TT+ +L   F AYG ++S  +  D   G S+G+ F+ F+  +   ++ A 
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQAD 92

Query: 190 G 192
           G
Sbjct: 93  G 93



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK G       FVGG+S + ++ ++   FS +GT+   ++  D+     KG+ F+TFE+E
Sbjct: 25  PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETE 83

Query: 402 Q 404
           Q
Sbjct: 84  Q 84


>X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal
           protein protein.
          Length = 366

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP TG+S+ FAFI F + E+ D  M A
Sbjct: 121 IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDA 180

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 181 MNGQYLCN 188



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  E+ +  + + FS FG IL+  ++  D    + K F FI F S
Sbjct: 122 FIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFAS 170


>BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p
           protein.
          Length = 347

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP TG+S+ FAFI F + E+ D  M A
Sbjct: 102 IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           + GGL  ++S+  +   F + G ++ V MP D+     +G+ F+ F SE+  +  +K   
Sbjct: 16  YAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  E+ +  + + FS FG IL+  ++  D    + K F FI F S
Sbjct: 103 FIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFAS 151


>BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p
           protein.
          Length = 545

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 90



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 41  YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 100

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 101 GALMGGRNIKVGRPSNMP 118


>AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p
           protein.
          Length = 545

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 90



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 41  YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 100

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 101 GALMGGRNIKVGRPSNMP 118


>AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint
           protein.
          Length = 637

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 182



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 133 YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 192

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 193 GALMGGRNIKVGRPSNMP 210


>AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U binding
           splicing factor protein.
          Length = 637

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 182



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 133 YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 192

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 193 GALMGGRNIKVGRPSNMP 210


>AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA
           protein.
          Length = 347

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L  E  +K L D F A+G I ++  +  DP TG+S+ FAFI F + E+ D  M A
Sbjct: 102 IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           + GGL  ++S+  +   F + G ++ V MP D+     +G+ F+ F SE+  +  +K   
Sbjct: 16  YAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIRVNKAS 90



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L  E+ +  + + FS FG IL+  ++  D    + K F FI F S
Sbjct: 103 FIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFAS 151


>AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD,
           isoform D protein.
          Length = 545

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 90



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 41  YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 100

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 101 GALMGGRNIKVGRPSNMP 118


>AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC,
           isoform C protein.
          Length = 545

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 90



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 41  YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 100

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 101 GALMGGRNIKVGRPSNMP 118


>AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB,
           isoform B protein.
          Length = 545

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 90



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 41  YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 100

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 101 GALMGGRNIKVGRPSNMP 118


>AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA,
           isoform A protein.
          Length = 637

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++VG +S+E  +  +R  F  +G I+SIN+  DP T + +GFAF+ ++ PE
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPE 182



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +S E+ +D IR  F+ FG I  + M +D    + KGF F+ +E  +     L+   
Sbjct: 133 YVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMN 192

Query: 435 RTI-GGKEVDVKRATPKP 485
             + GG+ + V R +  P
Sbjct: 193 GALMGGRNIKVGRPSNMP 210


>AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p
           protein.
          Length = 300

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+++  + N F  FG I +++MP D    + +GF FI +E SE     +    
Sbjct: 9   YVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
              + G+ + V  A P
Sbjct: 69  DSELCGRTIRVNLAKP 84



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           ++VGGL+ E T++ L + F  +G+I  I +  D  + R RGFAFI ++  E
Sbjct: 8   IYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSE 58


>AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-33
           protein.
          Length = 300

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+++  + N F  FG I +++MP D    + +GF FI +E SE     +    
Sbjct: 9   YVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
              + G+ + V  A P
Sbjct: 69  DSELCGRTIRVNLAKP 84



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           ++VGGL+ E T++ L + F  +G+I  I +  D  + R RGFAFI ++  E
Sbjct: 8   IYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSE 58


>AE014134-2808|AAF53587.1|  435|Drosophila melanogaster CG12288-PA
           protein.
          Length = 435

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 32/126 (25%), Positives = 68/126 (53%), Gaps = 3/126 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG L +  T+++LR+ F + GEI+ I    D + G  +G A++ F+ P+++   +   
Sbjct: 262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALELN 320

Query: 193 EHTINNKKVDPKKAKARH-GKILSEDSAVKSQMMK--SETSSVNLELS*KWRCPLTKQRT 363
           +  ++++ ++ ++ + +  G     D+A  S   K  S+T + N + S   +  L K++ 
Sbjct: 321 QTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKN-QNSAGAKKRLDKKKG 379

Query: 364 KERASV 381
           KE  S+
Sbjct: 380 KENGSL 385


>AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA
           protein.
          Length = 300

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+++  + N F  FG I +++MP D    + +GF FI +E SE     +    
Sbjct: 9   YVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMN 68

Query: 432 KRTIGGKEVDVKRATP 479
              + G+ + V  A P
Sbjct: 69  DSELCGRTIRVNLAKP 84



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           ++VGGL+ E T++ L + F  +G+I  I +  D  + R RGFAFI ++  E
Sbjct: 8   IYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSE 58


>BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p
           protein.
          Length = 791

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FVG LS E   ++LR+ F  +GEI    V  DP T +S+G+ F+ F K  E+   + A 
Sbjct: 454 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAM 513

Query: 190 GEHTINNKKV 219
               + ++ +
Sbjct: 514 NGQWLGSRSI 523



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSEI   ++R  F+ FG I +  +  D    + KG+ F++F +  +  + +    
Sbjct: 455 FVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMN 514

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 515 GQWLGSRSIRTNWATRKP 532


>AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p
           protein.
          Length = 505

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FVG LS E   ++LR+ F  +GEI    V  DP T +S+G+ F+ F K  E+   + A 
Sbjct: 168 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAM 227

Query: 190 GEHTINNKKV 219
               + ++ +
Sbjct: 228 NGQWLGSRSI 237



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSEI   ++R  F+ FG I +  +  D    + KG+ F++F +  +  + +    
Sbjct: 169 FVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMN 228

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 229 GQWLGSRSIRTNWATRKP 246


>AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p
           protein.
          Length = 594

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 393



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 338 YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 385


>AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-PA
           protein.
          Length = 505

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FVG LS E   ++LR+ F  +GEI    V  DP T +S+G+ F+ F K  E+   + A 
Sbjct: 168 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAM 227

Query: 190 GEHTINNKKV 219
               + ++ +
Sbjct: 228 NGQWLGSRSI 237



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSEI   ++R  F+ FG I +  +  D    + KG+ F++F +  +  + +    
Sbjct: 169 FVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMN 228

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 229 GQWLGSRSIRTNWATRKP 246


>AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-PG,
           isoform G protein.
          Length = 287

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 86



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 31  YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 78


>AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-PF,
           isoform F protein.
          Length = 287

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 86



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 31  YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 78


>AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-PE,
           isoform E protein.
          Length = 287

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 86



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 31  YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 78


>AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-PD,
           isoform D protein.
          Length = 287

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 86



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 31  YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 78


>AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-PC,
           isoform C protein.
          Length = 287

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 86



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 31  YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 78


>AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-PB,
           isoform B protein.
          Length = 594

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 393



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 338 YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 385


>AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-PA,
           isoform A protein.
          Length = 594

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  LR  F  +G+I++I +  D  TGRS+G+ FI +   +   K +
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKAL 393



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FIT+ +
Sbjct: 338 YVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHN 385


>X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>M31162-1|AAA28859.1|  448|Drosophila melanogaster protein (
           D.melanogaster U1 70Ksmall nuclear ribonucleoprotein
           gene, complete cds. ).
          Length = 448

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  ++++T++ +LR  F  YG I+ I +  D  +G+ +G+AFI ++    +    AA 
Sbjct: 104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH---AAY 160

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D K+
Sbjct: 161 KHA-DGKKIDSKR 172


>M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2
           protein C protein.
          Length = 179

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 71

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 72  SCSGIEVDGRR 82



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 61


>M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2
           protein B protein.
          Length = 226

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 118

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 119 SCSGIEVDGRR 129



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 108


>M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2
           protein A protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>M23633-1|AAA28953.1|  264|Drosophila melanogaster protein (
           D.melanogaster transformer-2 (tra-2) protein mRNA,
           complete cds. ).
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2
           protein.
          Length = 256

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 93  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 148

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 149 SCSGIEVDGRR 159



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 93  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 138


>BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p
           protein.
          Length = 437

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG +  E ++++++  FSE G +L +++ FD+   + KGF F  ++ ++     ++   
Sbjct: 19  FVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLN 78

Query: 435 -RTIGGKEVDVKRA 473
              IGG+ + V  A
Sbjct: 79  GYEIGGRTLRVDNA 92



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/52 (30%), Positives = 32/52 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FVG + +E T+++L++ F   G + S+ +  D  +G+ +GF F  +K  E+
Sbjct: 18  VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQET 69


>BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p
           protein.
          Length = 313

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +1

Query: 109 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           D  T R RGF F+ F+  + +D+V     HTI NKKV+ KKA+ +
Sbjct: 4   DQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 48



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +3

Query: 339 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           M  D+   + +GF F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 1   MLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 48


>AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p
           protein.
          Length = 918

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = +3

Query: 177 GHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKT 356
           G+  W   HQQ     ++  S +   F   L+   +++++R  F +FG ++EV +P DK 
Sbjct: 343 GNAKW--KHQQDSLSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKL 400

Query: 357 KNQRKGFCFITF 392
             + KGF  +T+
Sbjct: 401 TRKIKGFGTVTY 412



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           ++F   L++ TT+++LR  F  +G +  +N+  D  T + +GF  + +  PE
Sbjct: 365 RIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPE 416



 Score = 35.5 bits (78), Expect = 0.061
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS--RGFAFI 147
           K+ V  + ++   +E+RD F A+GE+ S+ +     TG    RGF F+
Sbjct: 786 KILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFV 833


>AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p
           protein.
          Length = 448

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  ++++T++ +LR  F  YG I+ I +  D  +G+ +G+AFI ++    +    AA 
Sbjct: 104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH---AAY 160

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D K+
Sbjct: 161 KHA-DGKKIDSKR 172


>AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p
           protein.
          Length = 448

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  ++++T++ +LR  F  YG I+ I +  D  +G+ +G+AFI ++    +    AA 
Sbjct: 104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH---AAY 160

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D K+
Sbjct: 161 KHA-DGKKIDSKR 172


>AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p
           protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage
           stimulation factor 64kilodalton subunit protein.
          Length = 419

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG +  E ++++++  FSE G +L +++ FD+   + KGF F  ++ ++     ++   
Sbjct: 19  FVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLN 78

Query: 435 -RTIGGKEVDVKRA 473
              IGG+ + V  A
Sbjct: 79  GYEIGGRTLRVDNA 92



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/52 (30%), Positives = 32/52 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FVG + +E T+++L++ F   G + S+ +  D  +G+ +GF F  +K  E+
Sbjct: 18  VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQET 69


>AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA
           protein.
          Length = 419

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG +  E ++++++  FSE G +L +++ FD+   + KGF F  ++ ++     ++   
Sbjct: 19  FVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLN 78

Query: 435 -RTIGGKEVDVKRA 473
              IGG+ + V  A
Sbjct: 79  GYEIGGRTLRVDNA 92



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/52 (30%), Positives = 32/52 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FVG + +E T+++L++ F   G + S+ +  D  +G+ +GF F  +K  E+
Sbjct: 18  VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQET 69


>AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA
           protein.
          Length = 918

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = +3

Query: 177 GHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKT 356
           G+  W   HQQ     ++  S +   F   L+   +++++R  F +FG ++EV +P DK 
Sbjct: 343 GNAKW--KHQQDSLSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKL 400

Query: 357 KNQRKGFCFITF 392
             + KGF  +T+
Sbjct: 401 TRKIKGFGTVTY 412



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           ++F   L++ TT+++LR  F  +G +  +N+  D  T + +GF  + +  PE
Sbjct: 365 RIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPE 416



 Score = 35.5 bits (78), Expect = 0.061
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS--RGFAFI 147
           K+ V  + ++   +E+RD F A+GE+ S+ +     TG    RGF F+
Sbjct: 786 KILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFV 833


>AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA
           protein.
          Length = 448

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  ++++T++ +LR  F  YG I+ I +  D  +G+ +G+AFI ++    +    AA 
Sbjct: 104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH---AAY 160

Query: 193 EHTINNKKVDPKK 231
           +H  + KK+D K+
Sbjct: 161 KHA-DGKKIDSKR 172


>AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-PE,
           isoform E protein.
          Length = 179

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 71

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 72  SCSGIEVDGRR 82



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 61


>AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-PD,
           isoform D protein.
          Length = 226

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 118

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 119 SCSGIEVDGRR 129



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 108


>AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-PC,
           isoform C protein.
          Length = 226

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 118

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 119 SCSGIEVDGRR 129



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 108


>AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-PG,
           isoform G protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-PF,
           isoform F protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-PA,
           isoform A protein.
          Length = 264

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GL++  S  ++R  F+++G I  ++M  D    + +GFCFI FE    ++D  +  K 
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK---LSD-ARAAKD 156

Query: 438 TIGGKEVDVKR 470
           +  G EVD +R
Sbjct: 157 SCSGIEVDGRR 167



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           V GL+  T+  ++R+ F  YG IE I +  D  T RSRGF FI F+
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146


>X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.
          Length = 213

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 16/37 (43%), Positives = 26/37 (70%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNT 120
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T
Sbjct: 176 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVT 212



 Score = 34.7 bits (76), Expect = 0.11
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV 335
           FVGGLS + S D+++ +F+ FGT+ +V
Sbjct: 178 FVGGLSWQTSSDKLKEYFNMFGTVTDV 204


>M59448-1|AAA28921.1|  366|Drosophila melanogaster Sxl protein.
          Length = 366

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 264

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 265 NNVIPEGGSQPLSVRLAEEHGK 286



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 179 NGITVRNKRL--KVSYARPG 196


>M59447-1|AAA28922.1|  354|Drosophila melanogaster Sx1 protein.
          Length = 354

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 213 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 272

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 273 NNVIPEGGSQPLSVRLAEEHGK 294



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 127 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 186

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 187 NGITVRNKRL--KVSYARPG 204


>M23636-1|AAA28884.1|  354|Drosophila melanogaster sex-linked
           protein protein.
          Length = 354

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 213 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 272

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 273 NNVIPEGGSQPLSVRLAEEHGK 294



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 127 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 186

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 187 NGITVRNKRL--KVSYARPG 204


>BT003583-1|AAO39587.1|  352|Drosophila melanogaster LD15933p
           protein.
          Length = 352

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 213 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 272

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 273 NNVIPEGGSQPLSVRLAEEHGK 294



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 127 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 186

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 187 NGITVRNKRL--KVSYARPG 204


>AE014298-1011|AAZ52512.1|  314|Drosophila melanogaster CG18350-PE,
           isoform E protein.
          Length = 314

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 173 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 232

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 233 NNVIPEGGSQPLSVRLAEEHGK 254



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 87  LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 146

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 147 NGITVRNKRL--KVSYARPG 164


>AE014298-1010|AAO41638.2|  314|Drosophila melanogaster CG18350-PA,
           isoform A protein.
          Length = 314

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 173 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 232

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 233 NNVIPEGGSQPLSVRLAEEHGK 254



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 87  LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 146

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 147 NGITVRNKRL--KVSYARPG 164


>AE014298-1009|AAF46241.3|  339|Drosophila melanogaster CG18350-PI,
           isoform I protein.
          Length = 339

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 198 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 257

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 258 NNVIPEGGSQPLSVRLAEEHGK 279



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 112 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 171

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 172 NGITVRNKRL--KVSYARPG 189


>AE014298-1008|AAZ52511.1|  354|Drosophila melanogaster CG18350-PL,
           isoform L protein.
          Length = 354

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 213 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 272

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 273 NNVIPEGGSQPLSVRLAEEHGK 294



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 127 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 186

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 187 NGITVRNKRL--KVSYARPG 204


>AE014298-1007|AAG22410.1|  354|Drosophila melanogaster CG18350-PD,
           isoform D protein.
          Length = 354

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 213 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 272

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 273 NNVIPEGGSQPLSVRLAEEHGK 294



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 127 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 186

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 187 NGITVRNKRL--KVSYARPG 204


>AE014298-1006|AAN09198.1|  346|Drosophila melanogaster CG18350-PJ,
           isoform J protein.
          Length = 346

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 264

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 265 NNVIPEGGSQPLSVRLAEEHGK 286



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 179 NGITVRNKRL--KVSYARPG 196


>AE014298-1005|AAN09200.2|  346|Drosophila melanogaster CG18350-PG,
           isoform G protein.
          Length = 346

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 264

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 265 NNVIPEGGSQPLSVRLAEEHGK 286



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 179 NGITVRNKRL--KVSYARPG 196


>AE014298-1004|AAZ52510.1|  344|Drosophila melanogaster CG18350-PN,
           isoform N protein.
          Length = 344

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 203 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 262

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 263 NNVIPEGGSQPLSVRLAEEHGK 284



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 117 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 176

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 177 NGITVRNKRL--KVSYARPG 194


>AE014298-1003|AAN09197.1|  344|Drosophila melanogaster CG18350-PC,
           isoform C protein.
          Length = 344

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 203 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 262

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 263 NNVIPEGGSQPLSVRLAEEHGK 284



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 117 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 176

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 177 NGITVRNKRL--KVSYARPG 194


>AE014298-1002|AAF46240.2|  366|Drosophila melanogaster CG18350-PH,
           isoform H protein.
          Length = 366

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 264

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 265 NNVIPEGGSQPLSVRLAEEHGK 286



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 179 NGITVRNKRL--KVSYARPG 196


>AE014298-1001|AAZ52509.1|  364|Drosophila melanogaster CG18350-PO,
           isoform O protein.
          Length = 364

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  L    TD +L   FG YG I   N+  D  TGR RG AF+ +   E   + ++A 
Sbjct: 203 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 262

Query: 193 EHTINNKKVDPKKAK--ARHGK 252
            + I      P   +    HGK
Sbjct: 263 NNVIPEGGSQPLSVRLAEEHGK 284



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           L V  L  + TD+EL   F A G I +  +  D  TG S G+AF+ F +  +S   +   
Sbjct: 117 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 176

Query: 190 GEHTINNKKVDPKKAKARHG 249
              T+ NK++  K + AR G
Sbjct: 177 NGITVRNKRL--KVSYARPG 194


>AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-PA
           protein.
          Length = 154

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/52 (36%), Positives = 31/52 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FV G  +  T+ +L   F  YGE+ +IN+  D  TG+S+GF F+ ++   S
Sbjct: 36  IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRS 87



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 13/50 (26%), Positives = 29/50 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FV G    +++ ++   FS++G ++ + +  D    + KGFCF+ +E ++
Sbjct: 37  FVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQR 86


>U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specific
           RNP-type RNA bindingprotein protein.
          Length = 808

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 356 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 403



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 358 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 403



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 726 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 785

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 786 NGFQVGTKRLKVQLKKPKDSK 806


>U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.
          Length = 604

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 152 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 154 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 522 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 581

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 582 NGFQVGTKRLKVQLKKPKDSK 602


>AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p
           protein.
          Length = 604

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 152 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 154 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 522 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 581

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 582 NGFQVGTKRLKVQLKKPKDSK 602


>AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-PA,
           isoform A protein.
          Length = 604

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 152 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 154 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 522 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 581

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 582 NGFQVGTKRLKVQLKKPKDSK 602


>AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-PC,
           isoform C protein.
          Length = 616

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 152 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 154 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 199



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 534 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 593

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 594 NGFQVGTKRLKVQLKKPKDSK 614


>AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-PB,
           isoform B protein.
          Length = 810

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +     + +LR+ F  YG + SINV  D  TG S+G  F+ F
Sbjct: 358 KMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 405



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R  F E+G +  + +  DK     KG CF+TF
Sbjct: 360 FVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTF 405



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           LF+  L  E TD +L   F  +G + S  V  D  T  S+ F F+ F  P+S    + A 
Sbjct: 728 LFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAM 787

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  K++  +  K +  K
Sbjct: 788 NGFQVGTKRLKVQLKKPKDSK 808


>L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-binding
           protein protein.
          Length = 632

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 24/52 (46%), Positives = 27/52 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F  PES
Sbjct: 287 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN-PES 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 183 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 240


>AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p
           protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p
           protein.
          Length = 449

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K++VGGL       ++++   ++GE++ +N+  D NT  ++GFAF  +  P   D  +A
Sbjct: 243 KIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIA 301



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           +VGGL + ++ D+++     FG +  + +  D   N  KGF F  +    V +  +    
Sbjct: 245 YVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLH 304

Query: 432 KRTIGGKEVDVKRATP 479
              +G + + V+R+ P
Sbjct: 305 GMLLGDRRLVVQRSIP 320


>AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p
           protein.
          Length = 307

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + L+V  LS E T++ LR+ F  YG I S  +  D   GRSR F F+ ++ P+S
Sbjct: 203 KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQS 255


>AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA
           protein.
          Length = 307

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + L+V  LS E T++ LR+ F  YG I S  +  D   GRSR F F+ ++ P+S
Sbjct: 203 KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQS 255


>AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA
           protein.
          Length = 449

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K++VGGL       ++++   ++GE++ +N+  D NT  ++GFAF  +  P   D  +A
Sbjct: 243 KIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIA 301



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           +VGGL + ++ D+++     FG +  + +  D   N  KGF F  +    V +  +    
Sbjct: 245 YVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLH 304

Query: 432 KRTIGGKEVDVKRATP 479
              +G + + V+R+ P
Sbjct: 305 GMLLGDRRLVVQRSIP 320


>AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH,
           isoform H protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG,
           isoform G protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF,
           isoform F protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE,
           isoform E protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD,
           isoform D protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC,
           isoform C protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB,
           isoform B protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA,
           isoform A protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+  L   I +  I + FS FG IL  ++  D+ K   KG+ F+ FE+E+  N  + K  
Sbjct: 93  FIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVN 151

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + GK+V V +  P+ +
Sbjct: 152 GMLLNGKKVYVGKFIPRKE 170



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           L+V  L     D  LR  F  YG I S  V TD   GRS+GF F+ F A
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNA 336



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L D F + G + SI V  D  T RS G+A++ F+ P   ++ +
Sbjct: 4   LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++V   + +  D++L++ F  YG+I S  V +  + G+S+GF F+ F+  E+ +  + A
Sbjct: 185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED-GKSKGFGFVAFETTEAAEAAVQA 242


>BT029945-1|ABM92819.1|  657|Drosophila melanogaster IP16959p
           protein.
          Length = 657

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  + ++  D +LR     +G +    +     +G S+G AF+ FKA ES D  + AG
Sbjct: 232 VFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQAG 291

Query: 193 -EHTINNKKVDPKKAKAR 243
            E  + ++ +DP  A +R
Sbjct: 292 TEFKLMDEVLDPHPALSR 309


>BT023833-1|AAZ86754.1|  657|Drosophila melanogaster LD27920p
           protein.
          Length = 657

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  + ++  D +LR     +G +    +     +G S+G AF+ FKA ES D  + AG
Sbjct: 232 VFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQAG 291

Query: 193 -EHTINNKKVDPKKAKAR 243
            E  + ++ +DP  A +R
Sbjct: 292 TEFKLMDEVLDPHPALSR 309


>BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p
           protein.
          Length = 865

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +     D ++R  F +FGTIL+VE+ F++  +  KGF F+TF +    ND  +  +R
Sbjct: 381 VSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGS--KGFGFVTFANS---NDAERARER 435

Query: 438 TIG----GKEVDVKRATPK 482
             G    G++++V  AT +
Sbjct: 436 LHGTVVEGRKIEVNNATAR 454


>AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p
           protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +     D ++R  F +FGTIL+VE+ F++  +  KGF F+TF +    ND  +  +R
Sbjct: 201 VSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGS--KGFGFVTFANS---NDAERARER 255

Query: 438 TIG----GKEVDVKRATPK 482
             G    G++++V  AT +
Sbjct: 256 LHGTVVEGRKIEVNNATAR 274


>AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p
           protein.
          Length = 251

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           +RP E  ST+   +VG L + + + ++R  F+ +G I++V +   K  N+ +G  F+ FE
Sbjct: 117 ARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           L+VG L     +K++R+ F  YG I  +N+       RSRG AF+ F+
Sbjct: 129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176


>AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA
           protein.
          Length = 251

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           +RP E  ST+   +VG L + + + ++R  F+ +G I++V +   K  N+ +G  F+ FE
Sbjct: 117 ARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           L+VG L     +K++R+ F  YG I  +N+       RSRG AF+ F+
Sbjct: 129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176


>AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-PB,
           isoform B protein.
          Length = 849

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +     D ++R  F +FGTIL+VE+ F++  +  KGF F+TF +    ND  +  +R
Sbjct: 439 VSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGS--KGFGFVTFANS---NDAERARER 493

Query: 438 TIG----GKEVDVKRATPK 482
             G    G++++V  AT +
Sbjct: 494 LHGTVVEGRKIEVNNATAR 512


>AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-PD,
           isoform D protein.
          Length = 881

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +     D ++R  F +FGTIL+VE+ F++  +  KGF F+TF +    ND  +  +R
Sbjct: 439 VSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGS--KGFGFVTFANS---NDAERARER 493

Query: 438 TIG----GKEVDVKRATPK 482
             G    G++++V  AT +
Sbjct: 494 LHGTVVEGRKIEVNNATAR 512


>AE013599-3932|AAF47253.2|  657|Drosophila melanogaster CG4806-PA
           protein.
          Length = 657

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  + ++  D +LR     +G +    +     +G S+G AF+ FKA ES D  + AG
Sbjct: 232 VFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQAG 291

Query: 193 -EHTINNKKVDPKKAKAR 243
            E  + ++ +DP  A +R
Sbjct: 292 TEFKLMDEVLDPHPALSR 309


>S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           FVGGLS +TT + LR  F  +G +    V  DP +  SRGF F+
Sbjct: 1   FVGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFM 44



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/44 (38%), Positives = 28/44 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           FVGGLS++ + + +R FFS+FG + +  +  D   N  +GF F+
Sbjct: 1   FVGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFM 44


>AY071005-1|AAL48627.1|  165|Drosophila melanogaster RE09075p
           protein.
          Length = 165

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LFV  +  E  + E+++ F  YGEI+SI++  D  TG S+G+A + ++
Sbjct: 75  LFVTSIHEEAQEDEIQEKFCDYGEIKSIHLNLDRRTGFSKGYALVEYE 122



 Score = 36.3 bits (80), Expect = 0.035
 Identities = 14/53 (26%), Positives = 27/53 (50%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           W  FV  +  E  +DEI+  F ++G I  + +  D+     KG+  + +E+ +
Sbjct: 73  WILFVTSIHEEAQEDEIQEKFCDYGEIKSIHLNLDRRTGFSKGYALVEYETHK 125


>L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding
           protein protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p
           protein.
          Length = 578

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 22/80 (27%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++ GL    +D ++ N  +++GTI+  +   DKT N+ KG+ F+ FE        +K   
Sbjct: 234 YIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVK--- 290

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK V  + A  +   P
Sbjct: 291 -GLQGKGVQAQMAKQQEQDP 309



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L++ GL   TTDK+L +    YG I S     D  T + +G+ F+ F+ P
Sbjct: 233 LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQP 282


>AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p
           protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p
           protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-binding
           protein II protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC,
           isoform C protein.
          Length = 368

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 22/80 (27%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++ GL    +D ++ N  +++GTI+  +   DKT N+ KG+ F+ FE        +K   
Sbjct: 24  YIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVK--- 80

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK V  + A  +   P
Sbjct: 81  -GLQGKGVQAQMAKQQEQDP 99



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L++ GL   TTDK+L +    YG I S     D  T + +G+ F+ F+ P
Sbjct: 23  LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQP 72


>AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA,
           isoform A protein.
          Length = 578

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 22/80 (27%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++ GL    +D ++ N  +++GTI+  +   DKT N+ KG+ F+ FE        +K   
Sbjct: 234 YIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVK--- 290

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK V  + A  +   P
Sbjct: 291 -GLQGKGVQAQMAKQQEQDP 309



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L++ GL   TTDK+L +    YG I S     D  T + +G+ F+ F+ P
Sbjct: 233 LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQP 282


>AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,
           isoform B protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AE013599-598|AAF59127.1|  224|Drosophila melanogaster CG2163-PA,
           isoform A protein.
          Length = 224

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  + +EL  HF   G I  + +  +   G  +GFA+I F + E ++  +A  
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 193 EHTINNKKV 219
           E     +++
Sbjct: 158 ETLFRGRQI 166



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    S +E+   F   GTI  V +  +K     KGF +I F S++ V   L   +
Sbjct: 99  YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE 158

Query: 435 RTIGGKEVDV-KRATPKP 485
               G+++ V  + T +P
Sbjct: 159 TLFRGRQIKVMSKRTNRP 176


>AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p
           protein.
          Length = 379

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           ++ GL    +D ++ N  +++GTI+  +   DKT N+ KG+ F+ FE
Sbjct: 24  YIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFE 70



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L++ GL   TTDK+L +    YG I S     D  T + +G+ F+ F+ P
Sbjct: 23  LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQP 72


>AE013599-786|AAF58987.1|  165|Drosophila melanogaster CG8781-PA
           protein.
          Length = 165

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/48 (35%), Positives = 31/48 (64%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LFV  +  E  + E+++ F  YGEI++I++  D  TG S+G+A + ++
Sbjct: 75  LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYE 122



 Score = 36.3 bits (80), Expect = 0.035
 Identities = 14/53 (26%), Positives = 27/53 (50%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           W  FV  +  E  +DEI+  F ++G I  + +  D+     KG+  + +E+ +
Sbjct: 73  WILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHK 125


>L23404-1|AAA03548.1|  416|Drosophila melanogaster RNA binding
           protein protein.
          Length = 416

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/105 (24%), Positives = 52/105 (49%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL     D ++++   ++G++ + N+  D  TG S+G+AF  +      D+ +A 
Sbjct: 208 KIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAG 267

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  KK   +   +     A  +Q   + T SV L++
Sbjct: 268 ----LNGMQLGDKKLIVQRASV----GAKNAQNAANTTQSVMLQV 304



 Score = 35.1 bits (77), Expect = 0.080
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN-DLLKTP 431
           F+GGL + ++DD+++     FG +    +  D      KG+ F  +    + +  +    
Sbjct: 210 FIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLN 269

Query: 432 KRTIGGKEVDVKRAT 476
              +G K++ V+RA+
Sbjct: 270 GMQLGDKKLIVQRAS 284


>AY069320-1|AAL39465.1|  416|Drosophila melanogaster LD03714p
           protein.
          Length = 416

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/105 (24%), Positives = 52/105 (49%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL     D ++++   ++G++ + N+  D  TG S+G+AF  +      D+ +A 
Sbjct: 208 KIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAG 267

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  KK   +   +     A  +Q   + T SV L++
Sbjct: 268 ----LNGMQLGDKKLIVQRASV----GAKNAQNAANTTQSVMLQV 304



 Score = 35.1 bits (77), Expect = 0.080
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN-DLLKTP 431
           F+GGL + ++DD+++     FG +    +  D      KG+ F  +    + +  +    
Sbjct: 210 FIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLN 269

Query: 432 KRTIGGKEVDVKRAT 476
              +G K++ V+RA+
Sbjct: 270 GMQLGDKKLIVQRAS 284


>AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA
           binding protein protein.
          Length = 356

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FV  L+ ET +  L   FG +G ++S+ V  D  T + +GF F+      E++  + + 
Sbjct: 275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSL 334

Query: 190 GEHTINNK 213
             +T+ N+
Sbjct: 335 NGYTLGNR 342



 Score = 35.5 bits (78), Expect = 0.061
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (7%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF----ESEQVVNDLL 422
           +V GL   +S  ++   F+ FG I+   +  D      KG  FI F    E+E+ + +L 
Sbjct: 133 YVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELN 192

Query: 423 -KTPK 434
            KTPK
Sbjct: 193 GKTPK 197



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLL 422
           W  FV  L+ E  ++ +   F  FG +  V++  D   ++ KGF F+T  + ++ V  + 
Sbjct: 273 WCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQ 332

Query: 423 KTPKRTIGGKEVDVKRATPK 482
                T+G + + V   T K
Sbjct: 333 SLNGYTLGNRVLQVSFKTNK 352


>AE014298-2376|AAF48596.1|  416|Drosophila melanogaster CG9998-PA
           protein.
          Length = 416

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/105 (24%), Positives = 52/105 (49%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL     D ++++   ++G++ + N+  D  TG S+G+AF  +      D+ +A 
Sbjct: 208 KIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAG 267

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  KK   +   +     A  +Q   + T SV L++
Sbjct: 268 ----LNGMQLGDKKLIVQRASV----GAKNAQNAANTTQSVMLQV 304



 Score = 35.1 bits (77), Expect = 0.080
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN-DLLKTP 431
           F+GGL + ++DD+++     FG +    +  D      KG+ F  +    + +  +    
Sbjct: 210 FIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLN 269

Query: 432 KRTIGGKEVDVKRAT 476
              +G K++ V+RA+
Sbjct: 270 GMQLGDKKLIVQRAS 284


>AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA
           protein.
          Length = 356

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FV  L+ ET +  L   FG +G ++S+ V  D  T + +GF F+      E++  + + 
Sbjct: 275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSL 334

Query: 190 GEHTINNK 213
             +T+ N+
Sbjct: 335 NGYTLGNR 342



 Score = 35.5 bits (78), Expect = 0.061
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (7%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF----ESEQVVNDLL 422
           +V GL   +S  ++   F+ FG I+   +  D      KG  FI F    E+E+ + +L 
Sbjct: 133 YVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELN 192

Query: 423 -KTPK 434
            KTPK
Sbjct: 193 GKTPK 197



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLL 422
           W  FV  L+ E  ++ +   F  FG +  V++  D   ++ KGF F+T  + ++ V  + 
Sbjct: 273 WCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQ 332

Query: 423 KTPKRTIGGKEVDVKRATPK 482
                T+G + + V   T K
Sbjct: 333 SLNGYTLGNRVLQVSFKTNK 352


>BT001315-1|AAN71070.1|  617|Drosophila melanogaster AT14906p
           protein.
          Length = 617

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 281 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 336



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 279 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 338


>BT001292-1|AAN71048.1|  582|Drosophila melanogaster AT10134p
           protein.
          Length = 582

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 246 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 301



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 244 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 303


>AY052043-1|AAK93467.1|  704|Drosophila melanogaster LP05645p
           protein.
          Length = 704

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG ++ V+ P     K+    KG+ F+ F+ E  V  L+
Sbjct: 450 FVGGLPPDIDEDEITTSFRRFGPLV-VDWPHKAESKSYFPPKGYAFLLFQDESSVQQLI 507


>AE014297-3308|AAN13938.2|  559|Drosophila melanogaster CG10868-PE,
           isoform E protein.
          Length = 559

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 223 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 278



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 221 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 280


>AE014297-3307|AAN13937.1|  559|Drosophila melanogaster CG10868-PC,
           isoform C protein.
          Length = 559

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 223 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 278



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 221 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 280


>AE014297-3306|AAN13936.2|  913|Drosophila melanogaster CG10868-PD,
           isoform D protein.
          Length = 913

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 577 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 632



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 575 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 634


>AE014297-3305|AAN13935.1|  913|Drosophila melanogaster CG10868-PB,
           isoform B protein.
          Length = 913

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 577 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 632



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 575 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 634


>AE014297-3304|AAF56120.1|  915|Drosophila melanogaster CG10868-PA,
           isoform A protein.
          Length = 915

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLL 422
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  LL
Sbjct: 579 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKALL 634



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  +++A
Sbjct: 577 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 636


>AE014296-1543|AAF50352.1|  551|Drosophila melanogaster CG5735-PA,
           isoform A protein.
          Length = 551

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG ++ V+ P     K+    KG+ F+ F+ E  V  L+
Sbjct: 297 FVGGLPPDIDEDEITTSFRRFGPLV-VDWPHKAESKSYFPPKGYAFLLFQDESSVQQLI 354


>AE014296-1542|AAN11975.1|  704|Drosophila melanogaster CG5735-PD,
           isoform D protein.
          Length = 704

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG ++ V+ P     K+    KG+ F+ F+ E  V  L+
Sbjct: 450 FVGGLPPDIDEDEITTSFRRFGPLV-VDWPHKAESKSYFPPKGYAFLLFQDESSVQQLI 507


>AE014296-1541|AAF50351.1|  704|Drosophila melanogaster CG5735-PC,
           isoform C protein.
          Length = 704

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG ++ V+ P     K+    KG+ F+ F+ E  V  L+
Sbjct: 450 FVGGLPPDIDEDEITTSFRRFGPLV-VDWPHKAESKSYFPPKGYAFLLFQDESSVQQLI 507


>AE014296-1540|AAF50350.1|  704|Drosophila melanogaster CG5735-PB,
           isoform B protein.
          Length = 704

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG ++ V+ P     K+    KG+ F+ F+ E  V  L+
Sbjct: 450 FVGGLPPDIDEDEITTSFRRFGPLV-VDWPHKAESKSYFPPKGYAFLLFQDESSVQQLI 507


>AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p
           protein.
          Length = 302

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++F G L  +  D+ L   F  +   +   V  D  TG+S+GF F+ F+ P    + M
Sbjct: 199 RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAM 256


>AY069434-1|AAL39579.1|  589|Drosophila melanogaster LD14125p
           protein.
          Length = 589

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LF G L     D ELR  FG YG ++ I++K  P  G    FAF+ ++
Sbjct: 112 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPP-PGTGNAFAFVRYQ 158



 Score = 34.7 bits (76), Expect = 0.11
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRK 371
           HH Q E  P     +T   F G L   I+DDE+R  F ++G +  ++++ P   T N   
Sbjct: 98  HHVQPEDDPL----STRTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGN--- 150

Query: 372 GFCFITFES 398
            F F+ +++
Sbjct: 151 AFAFVRYQN 159


>AF173550-1|AAL29185.1|  165|Drosophila melanogaster Tsunagi
           protein.
          Length = 165

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LFV  +  E    E+++ F  YGEI++I++  D  TG S+G+A + ++
Sbjct: 75  LFVTSIHEEAQGDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYE 122



 Score = 35.1 bits (77), Expect = 0.080
 Identities = 14/53 (26%), Positives = 26/53 (49%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           W  FV  +  E   DEI+  F ++G I  + +  D+     KG+  + +E+ +
Sbjct: 73  WILFVTSIHEEAQGDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHK 125


>AF145664-1|AAD38639.1|  793|Drosophila melanogaster BcDNA.GH11110
           protein.
          Length = 793

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LF G L     D ELR  FG YG ++ I++K  P  G    FAF+ ++
Sbjct: 316 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPP-PGTGNAFAFVRYQ 362



 Score = 34.7 bits (76), Expect = 0.11
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRK 371
           HH Q E  P     +T   F G L   I+DDE+R  F ++G +  ++++ P   T N   
Sbjct: 302 HHVQPEDDPL----STRTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGN--- 354

Query: 372 GFCFITFES 398
            F F+ +++
Sbjct: 355 AFAFVRYQN 363


>AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA
           protein.
          Length = 302

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++F G L  +  D+ L   F  +   +   V  D  TG+S+GF F+ F+ P    + M
Sbjct: 199 RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAM 256


>AE013599-555|AAF59160.1|  793|Drosophila melanogaster CG2910-PB,
           isoform B protein.
          Length = 793

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LF G L     D ELR  FG YG ++ I++K  P  G    FAF+ ++
Sbjct: 316 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPP-PGTGNAFAFVRYQ 362



 Score = 34.7 bits (76), Expect = 0.11
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRK 371
           HH Q E  P     +T   F G L   I+DDE+R  F ++G +  ++++ P   T N   
Sbjct: 302 HHVQPEDDPL----STRTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGN--- 354

Query: 372 GFCFITFES 398
            F F+ +++
Sbjct: 355 AFAFVRYQN 363


>AE013599-554|AAM68878.1|  793|Drosophila melanogaster CG2910-PA,
           isoform A protein.
          Length = 793

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LF G L     D ELR  FG YG ++ I++K  P  G    FAF+ ++
Sbjct: 316 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPP-PGTGNAFAFVRYQ 362



 Score = 34.7 bits (76), Expect = 0.11
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRK 371
           HH Q E  P     +T   F G L   I+DDE+R  F ++G +  ++++ P   T N   
Sbjct: 302 HHVQPEDDPL----STRTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGN--- 354

Query: 372 GFCFITFES 398
            F F+ +++
Sbjct: 355 AFAFVRYQN 363


>AY094788-1|AAM11141.1| 1521|Drosophila melanogaster LD15253p
           protein.
          Length = 1521

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 174 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 229

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 230 DGEHLGSNR 238



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 175 FIGNLEKDITAGELRSHFEAFGEIIEIDI 203


>AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends long
           isoform protein.
          Length = 5554

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 652 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 707

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 708 DGEHLGSNR 716



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 653 FIGNLEKDITAGELRSHFEAFGEIIEIDI 681


>AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP motif
           protein long isoformprotein.
          Length = 5533

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 658 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 713

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 714 DGEHLGSNR 722



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 659 FIGNLEKDITAGELRSHFEAFGEIIEIDI 687


>AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends
           protein.
          Length = 5476

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 601 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 656

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 657 DGEHLGSNR 665



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 602 FIGNLEKDITAGELRSHFEAFGEIIEIDI 630


>AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,
           isoform C protein.
          Length = 5476

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 601 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 656

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 657 DGEHLGSNR 665



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 602 FIGNLEKDITAGELRSHFEAFGEIIEIDI 630


>AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,
           isoform B protein.
          Length = 5533

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 658 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 713

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 714 DGEHLGSNR 722



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 659 FIGNLEKDITAGELRSHFEAFGEIIEIDI 687


>AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,
           isoform A protein.
          Length = 5560

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           LF+G L  + T  ELR HF A+GEI  I++K          +AF  +    S+ K M   
Sbjct: 658 LFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQ----GLNAYAFCQYSDIVSVVKAMRKM 713

Query: 190 -GEHTINNK 213
            GEH  +N+
Sbjct: 714 DGEHLGSNR 722



 Score = 31.5 bits (68), Expect = 0.99
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L  +I+  E+R+ F  FG I+E+++
Sbjct: 659 FIGNLEKDITAGELRSHFEAFGEIIEIDI 687


>AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p
           protein.
          Length = 170

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 225
           +++LR +F  +G +  + +     TG S+G+AF+ F+ PE + KV A    T++N  +  
Sbjct: 64  EQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPE-VAKVAA---DTMDNYLMFQ 119

Query: 226 KKAKARH 246
           K  KA +
Sbjct: 120 KVVKATY 126



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           + ++R +F +FG +L V +         KG+ F+ FE  +V
Sbjct: 64  EQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEV 104


>AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p
           protein.
          Length = 195

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L V  L++ TT ++LR  F   GE+  I +  D  T  SRGFAF+ F
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 71


>AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family
           splicing factor SC35 protein.
          Length = 195

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L V  L++ TT ++LR  F   GE+  I +  D  T  SRGFAF+ F
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 71


>AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA
           protein.
          Length = 356

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 225
           +++LR +F  +G +  + +     TG S+G+AF+ F+ PE + KV A    T++N  +  
Sbjct: 64  EQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPE-VAKVAA---DTMDNYLMFQ 119

Query: 226 KKAKARH 246
           K  KA +
Sbjct: 120 KVVKATY 126



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           + ++R +F +FG +L V +         KG+ F+ FE  +V
Sbjct: 64  EQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEV 104


>AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB,
           isoform B protein.
          Length = 195

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L V  L++ TT ++LR  F   GE+  I +  D  T  SRGFAF+ F
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 71


>X64412-1|CAA45757.1|  915|Drosophila melanogaster ovarian protein
           protein.
          Length = 915

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDL 419
           F+GG+  +IS+  +   F  FG+I +VE P  ++   Q KG+ +I FES++ V  L
Sbjct: 579 FLGGIPWDISEQSLIQIFKPFGSI-KVEWPGKEQQAAQPKGYVYIIFESDKQVKAL 633



 Score = 35.5 bits (78), Expect = 0.061
 Identities = 13/60 (21%), Positives = 34/60 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GG+ W+ +++ L   F  +G I+      +    + +G+ +I+F++ + +  + +A
Sbjct: 577 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALPSA 636


>BT003171-1|AAO24926.1|  443|Drosophila melanogaster SD07604p
           protein.
          Length = 443

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  LS    D  L   F  YG I   N+  D  TGR RG AF+ +   E   + + A 
Sbjct: 181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL 240

Query: 193 EHTINNKKVDP--KKAKARHGK 252
            +T+      P   +    HGK
Sbjct: 241 NNTVPEGGSQPIWVRLAEEHGK 262


>BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p
           protein.
          Length = 470

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           T++++R+ F  +G++ES+ +  + N G  +GF ++ F
Sbjct: 134 TEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170



 Score = 36.3 bits (80), Expect = 0.035
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           T+++ R+ F  YGEIE I V  D +T  ++G A++ F
Sbjct: 39  TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKF 75



 Score = 28.3 bits (60), Expect = 9.2
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +3

Query: 282 SDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           ++++IR  FS++G +  V +  +K     KGF ++ F
Sbjct: 134 TEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170


>BT001477-1|AAN71232.1|  443|Drosophila melanogaster LD21345p
           protein.
          Length = 443

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  LS    D  L   F  YG I   N+  D  TGR RG AF+ +   E   + + A 
Sbjct: 181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL 240

Query: 193 EHTINNKKVDP--KKAKARHGK 252
            +T+      P   +    HGK
Sbjct: 241 NNTVPEGGSQPIWVRLAEEHGK 262


>AY070578-1|AAL48049.1|  154|Drosophila melanogaster RE12122p
           protein.
          Length = 154

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/69 (30%), Positives = 32/69 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG LS   ++++I   FS  G +  + M  DK K    GFCF+    E  V    +   
Sbjct: 33  YVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFV----EYYVRSEAEAAM 88

Query: 435 RTIGGKEVD 461
           R + G  +D
Sbjct: 89  RFVNGTRLD 97



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 15/57 (26%), Positives = 28/57 (49%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG LS+ TT++++ + F   G++  I +  D       GF F+ +      +  M
Sbjct: 32  LYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAM 88


>AL023893-1|CAA19655.1|  485|Drosophila melanogaster EG:132E8.1
           protein.
          Length = 485

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  LS    D  L   F  YG I   N+  D  TGR RG AF+ +   E   + + A 
Sbjct: 181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL 240

Query: 193 EHTINNKKVDP--KKAKARHGK 252
            +T+      P   +    HGK
Sbjct: 241 NNTVPEGGSQPIWVRLAEEHGK 262


>AJ238969-1|CAB53185.1|  154|Drosophila melanogaster cap binding
           protein 20 protein.
          Length = 154

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/69 (30%), Positives = 32/69 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG LS   ++++I   FS  G +  + M  DK K    GFCF+    E  V    +   
Sbjct: 33  YVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFV----EYYVRSEAEAAM 88

Query: 435 RTIGGKEVD 461
           R + G  +D
Sbjct: 89  RFVNGTRLD 97



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 15/57 (26%), Positives = 28/57 (49%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG LS+ TT++++ + F   G++  I +  D       GF F+ +      +  M
Sbjct: 32  LYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAM 88


>AE014298-190|AAS65244.1|  443|Drosophila melanogaster CG3056-PB,
           isoform B protein.
          Length = 443

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  LS    D  L   F  YG I   N+  D  TGR RG AF+ +   E   + + A 
Sbjct: 181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL 240

Query: 193 EHTINNKKVDP--KKAKARHGK 252
            +T+      P   +    HGK
Sbjct: 241 NNTVPEGGSQPIWVRLAEEHGK 262


>AE014298-189|AAF45613.1|  485|Drosophila melanogaster CG3056-PA,
           isoform A protein.
          Length = 485

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V  LS    D  L   F  YG I   N+  D  TGR RG AF+ +   E   + + A 
Sbjct: 181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL 240

Query: 193 EHTINNKKVDP--KKAKARHGK 252
            +T+      P   +    HGK
Sbjct: 241 NNTVPEGGSQPIWVRLAEEHGK 262


>AE014297-2442|AAF55496.1|  154|Drosophila melanogaster CG12357-PA
           protein.
          Length = 154

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/69 (30%), Positives = 32/69 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG LS   ++++I   FS  G +  + M  DK K    GFCF+    E  V    +   
Sbjct: 33  YVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFV----EYYVRSEAEAAM 88

Query: 435 RTIGGKEVD 461
           R + G  +D
Sbjct: 89  RFVNGTRLD 97



 Score = 31.9 bits (69), Expect = 0.75
 Identities = 15/57 (26%), Positives = 28/57 (49%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG LS+ TT++++ + F   G++  I +  D       GF F+ +      +  M
Sbjct: 32  LYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAM 88


>AE014296-817|AAF47879.2|  470|Drosophila melanogaster CG1316-PA
           protein.
          Length = 470

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           T++++R+ F  +G++ES+ +  + N G  +GF ++ F
Sbjct: 134 TEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170



 Score = 36.3 bits (80), Expect = 0.035
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           T+++ R+ F  YGEIE I V  D +T  ++G A++ F
Sbjct: 39  TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKF 75



 Score = 28.3 bits (60), Expect = 9.2
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +3

Query: 282 SDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           ++++IR  FS++G +  V +  +K     KGF ++ F
Sbjct: 134 TEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170


>S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.
          Length = 444

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           L V  L    +  E+R  F ++GE+ES  +  D  TG+S G+ F+ +   E  +K + A
Sbjct: 112 LIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINA 170



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVN 413
           S+ W  FV  L+ +  ++ +   F  FG +  V++  D   N+ KGF F+T  + E+ V 
Sbjct: 358 SSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVL 417

Query: 414 DLLKTPKRTIGGKEVDVKRATPK 482
            +      T+G + + V   T K
Sbjct: 418 AIQSLNGYTLGNRVLQVSFKTNK 440



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FV  L+ +T +  L   FG +G ++S+ V  D  + + +GF F+      E++  + + 
Sbjct: 363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSL 422

Query: 190 GEHTINNK 213
             +T+ N+
Sbjct: 423 NGYTLGNR 430



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 6/68 (8%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF----ESEQVVNDL-- 419
           V  L   +S DEIR+ F  FG +   ++  DK   Q  G+ F+ +    ++E+ +N L  
Sbjct: 114 VNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNG 173

Query: 420 LKTPKRTI 443
           L+   +TI
Sbjct: 174 LRLQNKTI 181


>L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding
           protein protein.
          Length = 439

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           L V  L    +  E+R  F ++GE+ES  +  D  TG+S G+ F+ +   E  +K + A
Sbjct: 112 LIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINA 170



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 22/75 (29%), Positives = 31/75 (41%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+V GL    T  +L   F  YG+I +  +  D  TG S+G  FI F      D+ +   
Sbjct: 198 LYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKEL 257

Query: 193 EHTINNKKVDPKKAK 237
             T      +P   K
Sbjct: 258 NGTTPKNSTEPITVK 272



 Score = 37.1 bits (82), Expect = 0.020
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVN 413
           S+ W  FV  L+ +  ++ +   F  FG +  V++  D   N+ KGF F+T  + E+ V 
Sbjct: 353 SSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVL 412

Query: 414 DLLKTPKRTIGGKEVDVKRATPK 482
            +      T+G + + V   T K
Sbjct: 413 AIQSLNGYTLGNRVLQVSFKTNK 435



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           +FV  L+ +T +  L   FG +G ++S+ V  D  + + +GF F+      E++  + + 
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSL 417

Query: 190 GEHTINNK 213
             +T+ N+
Sbjct: 418 NGYTLGNR 425



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 6/68 (8%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF----ESEQVVNDL-- 419
           V  L   +S DEIR+ F  FG +   ++  DK   Q  G+ F+ +    ++E+ +N L  
Sbjct: 114 VNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNG 173

Query: 420 LKTPKRTI 443
           L+   +TI
Sbjct: 174 LRLQNKTI 181


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,255,508
Number of Sequences: 53049
Number of extensions: 504485
Number of successful extensions: 2445
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1830
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2428
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -