SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY095068-1|AAM11396.1|  110|Drosophila melanogaster RE14985p pro...    92   6e-19
AE014296-608|AAF47744.1|  110|Drosophila melanogaster CG17737-PA...    92   6e-19
AY118671-1|AAM50531.1| 1240|Drosophila melanogaster AT03020p pro...    31   2.0  
AY051517-1|AAK92941.1|  731|Drosophila melanogaster GH16956p pro...    30   2.6  
AE013599-2721|AAF57674.2|  731|Drosophila melanogaster CG30115-P...    30   2.6  
AE013599-2720|AAF57673.2| 1593|Drosophila melanogaster CG30115-P...    30   2.6  
BT022491-1|AAY54907.1|  173|Drosophila melanogaster IP07937p pro...    30   3.5  

>AY095068-1|AAM11396.1|  110|Drosophila melanogaster RE14985p
           protein.
          Length = 110

 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 39/43 (90%), Positives = 41/43 (95%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEVLQLQGDQRENICQWLTK GL KP+QLKVHGF
Sbjct: 68  GTVIEHPEYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110



 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 32/39 (82%), Positives = 37/39 (94%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           MSIQNLNT DPFADAIK ++DD+QDGLVH+RIQQRNGR+
Sbjct: 1   MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRK 39



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 25/27 (92%), Positives = 27/27 (100%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGLS+EYDLKKIVR+CKKEFAC
Sbjct: 40  TLTTVQGLSAEYDLKKIVRSCKKEFAC 66


>AE014296-608|AAF47744.1|  110|Drosophila melanogaster CG17737-PA
           protein.
          Length = 110

 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 39/43 (90%), Positives = 41/43 (95%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEVLQLQGDQRENICQWLTK GL KP+QLKVHGF
Sbjct: 68  GTVIEHPEYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110



 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 32/39 (82%), Positives = 37/39 (94%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           MSIQNLNT DPFADAIK ++DD+QDGLVH+RIQQRNGR+
Sbjct: 1   MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRK 39



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 25/27 (92%), Positives = 27/27 (100%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGLS+EYDLKKIVR+CKKEFAC
Sbjct: 40  TLTTVQGLSAEYDLKKIVRSCKKEFAC 66


>AY118671-1|AAM50531.1| 1240|Drosophila melanogaster AT03020p
           protein.
          Length = 1240

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 11/37 (29%), Positives = 23/37 (62%)
 Frame = +2

Query: 98  RSVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSEDDV 208
           R   ++QR+  F R ++ N ++FD F ++++  E+ V
Sbjct: 576 RRSEIRQRNSKFKRKTVANSSSFDSFNESLEQEEESV 612


>AY051517-1|AAK92941.1|  731|Drosophila melanogaster GH16956p
           protein.
          Length = 731

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 10/37 (27%), Positives = 23/37 (62%)
 Frame = +2

Query: 98  RSVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSEDDV 208
           R   ++QR+  F R ++ N ++FD F ++++  E+ +
Sbjct: 70  RRSEIRQRNSKFKRKTVANSSSFDSFNESLEQEEESI 106


>AE013599-2721|AAF57674.2|  731|Drosophila melanogaster CG30115-PC,
           isoform C protein.
          Length = 731

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 10/37 (27%), Positives = 23/37 (62%)
 Frame = +2

Query: 98  RSVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSEDDV 208
           R   ++QR+  F R ++ N ++FD F ++++  E+ +
Sbjct: 70  RRSEIRQRNSKFKRKTVANSSSFDSFNESLEQEEESI 106


>AE013599-2720|AAF57673.2| 1593|Drosophila melanogaster CG30115-PD,
            isoform D protein.
          Length = 1593

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 10/37 (27%), Positives = 23/37 (62%)
 Frame = +2

Query: 98   RSVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSEDDV 208
            R   ++QR+  F R ++ N ++FD F ++++  E+ +
Sbjct: 932  RRSEIRQRNSKFKRKTVANSSSFDSFNESLEQEEESI 968


>BT022491-1|AAY54907.1|  173|Drosophila melanogaster IP07937p
           protein.
          Length = 173

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 391 SP*SCSTSPYSGCSTTVPCTRTPSCMP 311
           +P  C+ +P   C+ T PCT TP C P
Sbjct: 24  TPPPCTRTP-PPCTRTPPCTTTPPCTP 49


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,713,129
Number of Sequences: 53049
Number of extensions: 633086
Number of successful extensions: 1973
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1863
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1965
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -