SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003793-1|AAO41476.1| 1000|Drosophila melanogaster GH07384p pro...    90   2e-18
AE014297-129|AAF52107.1| 1105|Drosophila melanogaster CG1059-PA ...    90   2e-18
BT024229-1|ABC86291.1| 1428|Drosophila melanogaster LP01445p pro...    28   9.1  
AE014296-335|AAF47551.2|  858|Drosophila melanogaster CG7991-PA ...    28   9.1  

>BT003793-1|AAO41476.1| 1000|Drosophila melanogaster GH07384p
           protein.
          Length = 1000

 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           + LQF+F CA++  P ++E+ +R+F+SVP +FGN++ + +D+IK ML  ++       +R
Sbjct: 128 DILQFLFQCANSPTPQLQESALRIFSSVPSIFGNQEAQYIDLIKQMLAKSMDAGSDPEVR 187

Query: 435 TQAVKAVGAFILLHDK--EPIIQKHF 506
            QAV+AVGAFIL HDK  E  I KHF
Sbjct: 188 VQAVRAVGAFILYHDKENETAIHKHF 213



 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 44/102 (43%), Positives = 60/102 (58%), Gaps = 3/102 (2%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           IQN   +E+ RQ AAVLLRRLF+              Q  L +Q+LL +Q +++  LRRK
Sbjct: 46  IQNGQQSEEARQMAAVLLRRLFTTEFFDFYKGLPAESQNQLLQQILLAVQQEVTPQLRRK 105

Query: 190 VCDVVSELARNHIDDDGNNQWPSSYS---SCLPVPVRKIQTS 306
           +C+VV+E+ARN ID+D NNQWP        C   P  ++Q S
Sbjct: 106 ICEVVAEVARNLIDEDCNNQWPDILQFLFQCANSPTPQLQES 147



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +2

Query: 497 KAFQDVLLPLMQVIVLSIEAADDDSALKVLIELADQHLNFSDP 625
           K F D+L  ++ +   +IEA DD S LK+LIE+ +    F  P
Sbjct: 211 KHFADMLPRMIHITGETIEAQDDQSLLKLLIEMTENCPKFLRP 253


>AE014297-129|AAF52107.1| 1105|Drosophila melanogaster CG1059-PA
           protein.
          Length = 1105

 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           + LQF+F CA++  P ++E+ +R+F+SVP +FGN++ + +D+IK ML  ++       +R
Sbjct: 128 DILQFLFQCANSPTPQLQESALRIFSSVPSIFGNQEAQYIDLIKQMLAKSMDAGSDPEVR 187

Query: 435 TQAVKAVGAFILLHDK--EPIIQKHF 506
            QAV+AVGAFIL HDK  E  I KHF
Sbjct: 188 VQAVRAVGAFILYHDKENETAIHKHF 213



 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 44/102 (43%), Positives = 60/102 (58%), Gaps = 3/102 (2%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           IQN   +E+ RQ AAVLLRRLF+              Q  L +Q+LL +Q +++  LRRK
Sbjct: 46  IQNGQQSEEARQMAAVLLRRLFTTEFFDFYKGLPAESQNQLLQQILLAVQQEVTPQLRRK 105

Query: 190 VCDVVSELARNHIDDDGNNQWPSSYS---SCLPVPVRKIQTS 306
           +C+VV+E+ARN ID+D NNQWP        C   P  ++Q S
Sbjct: 106 ICEVVAEVARNLIDEDCNNQWPDILQFLFQCANSPTPQLQES 147



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +2

Query: 497 KAFQDVLLPLMQVIVLSIEAADDDSALKVLIELADQHLNFSDP 625
           K F D+L  ++ +   +IEA DD S LK+LIE+ +    F  P
Sbjct: 211 KHFADMLPRMIHITGETIEAQDDQSLLKLLIEMTENCPKFLRP 253


>BT024229-1|ABC86291.1| 1428|Drosophila melanogaster LP01445p
           protein.
          Length = 1428

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = -2

Query: 566 HHQLLQ*-TELLPASKVEEHPEMLLYDGLLI 477
           HH L    TELLP+S + E PE LL  G+ +
Sbjct: 183 HHSLETCETELLPSSSIAELPEKLLTSGVYL 213


>AE014296-335|AAF47551.2|  858|Drosophila melanogaster CG7991-PA
           protein.
          Length = 858

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +2

Query: 272 VYLCQCARSKHQRSWY*NVYVCTR 343
           V LC+C  SK QR W+   YV TR
Sbjct: 821 VTLCECRESKDQRQWF---YVRTR 841


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,007,312
Number of Sequences: 53049
Number of extensions: 606302
Number of successful extensions: 1257
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1254
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2641708800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -