SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT011355-1|AAR96147.1|  248|Drosophila melanogaster RE70822p pro...    87   2e-17
AY061044-1|AAL28592.1|  262|Drosophila melanogaster LD01461p pro...    87   2e-17
AE014296-2523|AAF49626.2|  262|Drosophila melanogaster CG7945-PA...    87   2e-17
AE014296-2522|AAF49625.1|  248|Drosophila melanogaster CG7945-PB...    87   2e-17
AY129435-1|AAM76177.1|  142|Drosophila melanogaster LD01950p pro...    61   1e-09
AE014296-2524|AAS64995.1|  142|Drosophila melanogaster CG7945-PC...    61   1e-09
AY119525-1|AAM50179.1| 2019|Drosophila melanogaster GH15728p pro...    31   1.4  
AE014296-292|AAF47517.1| 2019|Drosophila melanogaster CG13917-PA...    31   1.4  
U91980-1|AAC47506.1| 2346|Drosophila melanogaster Tpr homolog pr...    30   2.4  
BT001737-1|AAN71492.1|  442|Drosophila melanogaster RE72573p pro...    30   2.4  
AE013599-1350|AAF58615.1| 2346|Drosophila melanogaster CG8274-PA...    30   2.4  
AY069225-1|AAL39370.1|  287|Drosophila melanogaster GH27237p pro...    29   7.4  
AE014298-1296|AAF46459.1|  287|Drosophila melanogaster CG12056-P...    29   7.4  
M16152-1|AAB59220.1| 2703|Drosophila melanogaster Notch growth f...    28   9.8  
K03508-1|AAA28725.1| 2703|Drosophila melanogaster developmental ...    28   9.8  
AY113213-1|AAM29218.1|  975|Drosophila melanogaster AT07178p pro...    28   9.8  
AY058725-1|AAL13954.1|  548|Drosophila melanogaster LD46533p pro...    28   9.8  
AL035436-2|CAB37610.1| 2704|Drosophila melanogaster EG:140G11.1,...    28   9.8  
AE014298-493|AAF45848.2| 2703|Drosophila melanogaster CG3936-PA ...    28   9.8  
AE014134-2857|AAF53621.1|  548|Drosophila melanogaster CG6453-PA...    28   9.8  
AE013599-1778|AAM71009.1|  975|Drosophila melanogaster CG30485-P...    28   9.8  

>BT011355-1|AAR96147.1|  248|Drosophila melanogaster RE70822p
           protein.
          Length = 248

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ RVE+LRKD + ++E+KD LL ++D IK +E++ ++SE ++++I  Y  R+ SR  TV
Sbjct: 84  LDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATV 143

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           E+ VRT RD+ QE++L Q+N+ IDS
Sbjct: 144 ELRVRTVRDNSQEDSLSQINVLIDS 168


>AY061044-1|AAL28592.1|  262|Drosophila melanogaster LD01461p
           protein.
          Length = 262

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ RVE+LRKD + ++E+KD LL ++D IK +E++ ++SE ++++I  Y  R+ SR  TV
Sbjct: 98  LDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATV 157

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           E+ VRT RD+ QE++L Q+N+ IDS
Sbjct: 158 ELRVRTVRDNSQEDSLSQINVLIDS 182


>AE014296-2523|AAF49626.2|  262|Drosophila melanogaster CG7945-PA,
           isoform A protein.
          Length = 262

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ RVE+LRKD + ++E+KD LL ++D IK +E++ ++SE ++++I  Y  R+ SR  TV
Sbjct: 98  LDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATV 157

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           E+ VRT RD+ QE++L Q+N+ IDS
Sbjct: 158 ELRVRTVRDNSQEDSLSQINVLIDS 182


>AE014296-2522|AAF49625.1|  248|Drosophila melanogaster CG7945-PB,
           isoform B protein.
          Length = 248

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ RVE+LRKD + ++E+KD LL ++D IK +E++ ++SE ++++I  Y  R+ SR  TV
Sbjct: 84  LDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATV 143

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           E+ VRT RD+ QE++L Q+N+ IDS
Sbjct: 144 ELRVRTVRDNSQEDSLSQINVLIDS 168


>AY129435-1|AAM76177.1|  142|Drosophila melanogaster LD01950p
           protein.
          Length = 142

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 27/61 (44%), Positives = 45/61 (73%)
 Frame = +2

Query: 329 TLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTDRDHQQEEALYQVNMYID 508
           ++D IK +E++ ++SE ++++I  Y  R+ SR  TVE+ VRT RD+ QE++L Q+N+ ID
Sbjct: 2   SMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATVELRVRTVRDNSQEDSLSQINVLID 61

Query: 509 S 511
           S
Sbjct: 62  S 62


>AE014296-2524|AAS64995.1|  142|Drosophila melanogaster CG7945-PC,
           isoform C protein.
          Length = 142

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 27/61 (44%), Positives = 45/61 (73%)
 Frame = +2

Query: 329 TLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTDRDHQQEEALYQVNMYID 508
           ++D IK +E++ ++SE ++++I  Y  R+ SR  TVE+ VRT RD+ QE++L Q+N+ ID
Sbjct: 2   SMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATVELRVRTVRDNSQEDSLSQINVLID 61

Query: 509 S 511
           S
Sbjct: 62  S 62


>AY119525-1|AAM50179.1| 2019|Drosophila melanogaster GH15728p protein.
          Length = 2019

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query: 179  TTTPHRRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEE--EKDSLLSTLDSIKHS 352
            + +P+    GS N G    ++     V+ R+++ R+D V+I E  +K SL S  + I  S
Sbjct: 815  SVSPYDDFSGS-NPGISSCSEEEQGQVQGRIKKRRRD-VQINETYDKSSLASVTEGIL-S 871

Query: 353  ELLLDISECDKDDITRYADRILSRAMTVEVTV 448
            + L   S  D DD+T   D  L++     V+V
Sbjct: 872  KDLSPASNTDTDDLTFQQDEQLAKEQAELVSV 903


>AE014296-292|AAF47517.1| 2019|Drosophila melanogaster CG13917-PA
            protein.
          Length = 2019

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query: 179  TTTPHRRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEE--EKDSLLSTLDSIKHS 352
            + +P+    GS N G    ++     V+ R+++ R+D V+I E  +K SL S  + I  S
Sbjct: 815  SVSPYDDFSGS-NPGISSCSEEEQGQVQGRIKKRRRD-VQINETYDKSSLASVTEGIL-S 871

Query: 353  ELLLDISECDKDDITRYADRILSRAMTVEVTV 448
            + L   S  D DD+T   D  L++     V+V
Sbjct: 872  KDLSPASNTDTDDLTFQQDEQLAKEQAELVSV 903


>U91980-1|AAC47506.1| 2346|Drosophila melanogaster Tpr homolog
           protein.
          Length = 2346

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSR-AMTV 436
           E  + +LRK+   + EE+DS++  ++  + +EL     E  K D+  Y  ++ S  A   
Sbjct: 103 EQTISQLRKEKASVVEERDSMMKVIER-QQAEL-----ERLKQDLHTYQQQLSSAIAAKC 156

Query: 437 EVTVRTDRDHQQEEAL 484
           E   R D    +E AL
Sbjct: 157 EAIARVDEIQSKEVAL 172


>BT001737-1|AAN71492.1|  442|Drosophila melanogaster RE72573p
           protein.
          Length = 442

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSR-AMTV 436
           E  + +LRK+   + EE+DS++  ++  + +EL     E  K D+  Y  ++ S  A   
Sbjct: 103 EQTISQLRKEKASVVEERDSMMKVIER-QQAEL-----ERLKQDLHTYQQQLSSAIAAKC 156

Query: 437 EVTVRTDRDHQQEEAL 484
           E   R D    +E AL
Sbjct: 157 EAIARVDEIQSKEVAL 172


>AE013599-1350|AAF58615.1| 2346|Drosophila melanogaster CG8274-PA
           protein.
          Length = 2346

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSR-AMTV 436
           E  + +LRK+   + EE+DS++  ++  + +EL     E  K D+  Y  ++ S  A   
Sbjct: 103 EQTISQLRKEKASVVEERDSMMKVIER-QQAEL-----ERLKQDLHTYQQQLSSAIAAKC 156

Query: 437 EVTVRTDRDHQQEEAL 484
           E   R D    +E AL
Sbjct: 157 EAIARVDEIQSKEVAL 172


>AY069225-1|AAL39370.1|  287|Drosophila melanogaster GH27237p
           protein.
          Length = 287

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 13/37 (35%), Positives = 17/37 (45%)
 Frame = -2

Query: 512 SYRCTCSPDTELPPADGLGQCALSPLRS*PGTGCGPR 402
           S++C C PD EL   D  G+ A       P   C P+
Sbjct: 243 SFQCACVPDAELDEIDAGGKVAHGDAMLKPYDNCEPQ 279


>AE014298-1296|AAF46459.1|  287|Drosophila melanogaster CG12056-PA
           protein.
          Length = 287

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 13/37 (35%), Positives = 17/37 (45%)
 Frame = -2

Query: 512 SYRCTCSPDTELPPADGLGQCALSPLRS*PGTGCGPR 402
           S++C C PD EL   D  G+ A       P   C P+
Sbjct: 243 SFQCACVPDAELDEIDAGGKVAHGDAMLKPYDNCEPQ 279


>M16152-1|AAB59220.1| 2703|Drosophila melanogaster Notch growth factor
            protein.
          Length = 2703

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +1

Query: 544  AHSRCQTYMNACTSQPDPNAGTTRTL 621
            A S CQ  ++ C SQP  N GT R L
Sbjct: 1176 AGSYCQKEIDECQSQPCQNGGTCRDL 1201


>K03508-1|AAA28725.1| 2703|Drosophila melanogaster developmental
            protein protein.
          Length = 2703

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +1

Query: 544  AHSRCQTYMNACTSQPDPNAGTTRTL 621
            A S CQ  ++ C SQP  N GT R L
Sbjct: 1176 AGSYCQKEIDECQSQPCQNGGTCRDL 1201


>AY113213-1|AAM29218.1|  975|Drosophila melanogaster AT07178p
           protein.
          Length = 975

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 3/33 (9%)
 Frame = -2

Query: 527 CTDITSYR---CTCSPDTELPPADGLGQCALSP 438
           CT I  +R   C+C P  E PP   L Q A +P
Sbjct: 179 CTKIDCFRHRDCSCPPKNESPPQPPLSQEASNP 211


>AY058725-1|AAL13954.1|  548|Drosophila melanogaster LD46533p
           protein.
          Length = 548

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 33/135 (24%), Positives = 54/135 (40%), Gaps = 15/135 (11%)
 Frame = +2

Query: 149 CIRDCVSRGFTTTPHRRILGS-RNAGAERQTDSSTR*VEMRVER---------LRKDTVR 298
           C   C+  G      RR        GAER+ +  TR  +MR ER          RK+   
Sbjct: 126 CPNTCLELGAAAAVQRRNAAELHKRGAERRQEMITRGKQMRAEREARRLELDQRRKEQEL 185

Query: 299 IEEEKDSLLSTLDSIKHSEL-LLDISECDKDDITRYADR----ILSRAMTVEVTVRTDRD 463
           +  EK+ L  T ++++   + +    + + D  T  A+R    +   A    V   T++D
Sbjct: 186 LRAEKEQLKQTAEALEAEAIEIFKEQQREVDADTAQAEREPQQMRQEATLTFVRYDTNKD 245

Query: 464 HQQEEALYQVNMYID 508
              E     V+M +D
Sbjct: 246 GFVEVTELMVDMNLD 260


>AL035436-2|CAB37610.1| 2704|Drosophila melanogaster
            EG:140G11.1,FBgn0004647;N protein.
          Length = 2704

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +1

Query: 544  AHSRCQTYMNACTSQPDPNAGTTRTL 621
            A S CQ  ++ C SQP  N GT R L
Sbjct: 1176 AGSYCQKEIDECQSQPCQNGGTCRDL 1201


>AE014298-493|AAF45848.2| 2703|Drosophila melanogaster CG3936-PA
            protein.
          Length = 2703

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +1

Query: 544  AHSRCQTYMNACTSQPDPNAGTTRTL 621
            A S CQ  ++ C SQP  N GT R L
Sbjct: 1176 AGSYCQKEIDECQSQPCQNGGTCRDL 1201


>AE014134-2857|AAF53621.1|  548|Drosophila melanogaster CG6453-PA
           protein.
          Length = 548

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 33/135 (24%), Positives = 54/135 (40%), Gaps = 15/135 (11%)
 Frame = +2

Query: 149 CIRDCVSRGFTTTPHRRILGS-RNAGAERQTDSSTR*VEMRVER---------LRKDTVR 298
           C   C+  G      RR        GAER+ +  TR  +MR ER          RK+   
Sbjct: 126 CPNTCLELGAAAAVQRRNAAELHKRGAERRQEMITRGKQMRAEREARRLELDQRRKEQEL 185

Query: 299 IEEEKDSLLSTLDSIKHSEL-LLDISECDKDDITRYADR----ILSRAMTVEVTVRTDRD 463
           +  EK+ L  T ++++   + +    + + D  T  A+R    +   A    V   T++D
Sbjct: 186 LRAEKEQLKQTAEALEAEAIEIFKEQQREVDADTAQAEREPQQMRQEATLTFVRYDTNKD 245

Query: 464 HQQEEALYQVNMYID 508
              E     V+M +D
Sbjct: 246 GFVEVTELMVDMNLD 260


>AE013599-1778|AAM71009.1|  975|Drosophila melanogaster CG30485-PA
           protein.
          Length = 975

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 3/33 (9%)
 Frame = -2

Query: 527 CTDITSYR---CTCSPDTELPPADGLGQCALSP 438
           CT I  +R   C+C P  E PP   L Q A +P
Sbjct: 179 CTKIDCFRHRDCSCPPKNESPPQPPLSQEASNP 211


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,679,734
Number of Sequences: 53049
Number of extensions: 691799
Number of successful extensions: 1729
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1587
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1729
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -