SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT011106-1|AAR82773.1| 1434|Drosophila melanogaster LP05394p pro...    91   2e-18
AY060861-1|AAL28409.1|  441|Drosophila melanogaster GM03427p pro...    91   2e-18
AE014297-2624|AAF55634.2| 1784|Drosophila melanogaster CG6040-PA...    91   2e-18
BT010204-1|AAQ23522.1|  879|Drosophila melanogaster SD17974p pro...    32   0.67 
AE014298-25|AAN09014.2|  879|Drosophila melanogaster CG3777-PC, ...    32   0.67 
AE014298-24|AAN09013.2|  879|Drosophila melanogaster CG3777-PB, ...    32   0.67 
AE014298-23|AAF45496.2|  879|Drosophila melanogaster CG3777-PA, ...    32   0.67 
AE014297-1796|AAF55017.1|  632|Drosophila melanogaster CG12402-P...    31   2.1  
BT015250-1|AAT94479.1| 1246|Drosophila melanogaster LP19005p pro...    29   4.7  
AY005815-1|AAF91072.1| 1678|Drosophila melanogaster arrow protein.     29   4.7  
AF223365-1|AAF28358.1| 1678|Drosophila melanogaster LDL-related ...    29   4.7  
AE013599-1719|AAF58373.2| 1678|Drosophila melanogaster CG5912-PA...    29   4.7  
AF172329-1|AAF02618.1| 3579|Drosophila melanogaster starry night...    29   6.3  
AE013599-1158|AAF58763.4| 3574|Drosophila melanogaster CG11895-P...    29   6.3  
AB028498-1|BAA84069.1| 3575|Drosophila melanogaster Flamingo pro...    29   6.3  

>BT011106-1|AAR82773.1| 1434|Drosophila melanogaster LP05394p protein.
          Length = 1434

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/65 (63%), Positives = 53/65 (81%)
 Frame = +3

Query: 39   TNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRW 218
            TN+LR+RKGRSVVH+ +EDNY AVV+ANHEALAQVL+Q+QQ+  +  +LR L    NLR+
Sbjct: 1141 TNRLRMRKGRSVVHKTIEDNYTAVVVANHEALAQVLDQLQQTPVVPAALRPLANAINLRY 1200

Query: 219  SDFTV 233
             DFT+
Sbjct: 1201 EDFTI 1205



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +2

Query: 257  GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLS--LNAITEFCDLVPRQQ 430
            G++ F  A+W+S SPV + L     Q+   +  + S     +S  LN +TEFCDLVP  Q
Sbjct: 1215 GKKAFHAALWSS-SPVTLALSADCNQLGG-VAGELSQLSGGVSDVLNPVTEFCDLVPSYQ 1272

Query: 431  ---FGEDGDDLVQATIVVLAQAQVDTLQSMAKV 520
                      L+QATI VL + Q++TLQS+  +
Sbjct: 1273 LPLMPSTEVTLLQATISVLPRLQLETLQSIGSI 1305



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +1

Query: 541  STNSQLVPT---EQVHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
            STN+  +P        E  F+MLQL+NG+K LQA+ +EE   +LS+ V  ++
Sbjct: 1368 STNANAMPAFDDVMTREVAFIMLQLVNGMKNLQAKAIEETPLSLSNVVLSKD 1419


>AY060861-1|AAL28409.1|  441|Drosophila melanogaster GM03427p
           protein.
          Length = 441

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/65 (63%), Positives = 53/65 (81%)
 Frame = +3

Query: 39  TNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRW 218
           TN+LR+RKGRSVVH+ +EDNY AVV+ANHEALAQVL+Q+QQ+  +  +LR L    NLR+
Sbjct: 12  TNRLRMRKGRSVVHKTIEDNYTAVVVANHEALAQVLDQLQQTPVVPAALRPLANAINLRY 71

Query: 219 SDFTV 233
            DFT+
Sbjct: 72  EDFTI 76



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +2

Query: 257 GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLS--LNAITEFCDLVPRQQ 430
           G++ F  A+W+S SPV + L     Q+   +  + S     +S  LN +TEFCDLVP  Q
Sbjct: 86  GKKAFHAALWSS-SPVTLALSADCNQLGG-VAGELSQLSGGVSDVLNPVTEFCDLVPSYQ 143

Query: 431 ---FGEDGDDLVQATIVVLAQAQVDTLQSMAKV 520
                     L+QATI VL + Q++TLQS+  +
Sbjct: 144 LPLMPSTEVTLLQATISVLPRLQLETLQSIGSI 176



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +1

Query: 541 STNSQLVPT---EQVHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
           STN+  VP        E  F+MLQL+NG+K LQA+ +EE   +LS+ V  ++
Sbjct: 239 STNANAVPAFDDVMTREVAFIMLQLVNGMKNLQAKAIEETPLSLSNVVLSKD 290


>AE014297-2624|AAF55634.2| 1784|Drosophila melanogaster CG6040-PA
            protein.
          Length = 1784

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/65 (63%), Positives = 53/65 (81%)
 Frame = +3

Query: 39   TNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRW 218
            TN+LR+RKGRSVVH+ +EDNY AVV+ANHEALAQVL+Q+QQ+  +  +LR L    NLR+
Sbjct: 1355 TNRLRMRKGRSVVHKTIEDNYTAVVVANHEALAQVLDQLQQTPVVPAALRPLANAINLRY 1414

Query: 219  SDFTV 233
             DFT+
Sbjct: 1415 EDFTI 1419



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +2

Query: 257  GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLS--LNAITEFCDLVPRQQ 430
            G++ F  A+W+S SPV + L     Q+   +  + S     +S  LN +TEFCDLVP  Q
Sbjct: 1429 GKKAFHAALWSS-SPVTLALSADCNQLGG-VAGELSQLSGGVSDVLNPVTEFCDLVPSYQ 1486

Query: 431  ---FGEDGDDLVQATIVVLAQAQVDTLQSMAKV 520
                      L+QATI VL + Q++TLQS+  +
Sbjct: 1487 LPLMPSTEVTLLQATISVLPRLQLETLQSIGSI 1519



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +1

Query: 541  STNSQLVPT---EQVHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
            STN+  +P        E  F+MLQL+NG+K LQA+ +EE   +LS+ V  ++
Sbjct: 1582 STNANAMPAFDDVMTREVAFIMLQLVNGMKNLQAKAIEETPLSLSNVVLSKD 1633


>BT010204-1|AAQ23522.1|  879|Drosophila melanogaster SD17974p
           protein.
          Length = 879

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 451 FSTSN-HRGFGPSTGGHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMMLQLING--LK 621
           F TS+ H G G    G  T H  S+R+ ++   +  L+PT++  E   ++  LIN   +K
Sbjct: 45  FETSHKHPGAGEWVEGFQTSHKISIRATDSADYSMNLLPTKERPELNPVLSALINEDVMK 104

Query: 622 CLQA-RGVEE 648
            ++A R +EE
Sbjct: 105 SIEAKRAIEE 114


>AE014298-25|AAN09014.2|  879|Drosophila melanogaster CG3777-PC,
           isoform C protein.
          Length = 879

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 451 FSTSN-HRGFGPSTGGHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMMLQLING--LK 621
           F TS+ H G G    G  T H  S+R+ ++   +  L+PT++  E   ++  LIN   +K
Sbjct: 45  FETSHKHPGAGEWVEGFQTSHKISIRATDSADYSMNLLPTKERPELNPVLSALINEDVMK 104

Query: 622 CLQA-RGVEE 648
            ++A R +EE
Sbjct: 105 SIEAKRAIEE 114


>AE014298-24|AAN09013.2|  879|Drosophila melanogaster CG3777-PB,
           isoform B protein.
          Length = 879

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 451 FSTSN-HRGFGPSTGGHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMMLQLING--LK 621
           F TS+ H G G    G  T H  S+R+ ++   +  L+PT++  E   ++  LIN   +K
Sbjct: 45  FETSHKHPGAGEWVEGFQTSHKISIRATDSADYSMNLLPTKERPELNPVLSALINEDVMK 104

Query: 622 CLQA-RGVEE 648
            ++A R +EE
Sbjct: 105 SIEAKRAIEE 114


>AE014298-23|AAF45496.2|  879|Drosophila melanogaster CG3777-PA,
           isoform A protein.
          Length = 879

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 451 FSTSN-HRGFGPSTGGHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMMLQLING--LK 621
           F TS+ H G G    G  T H  S+R+ ++   +  L+PT++  E   ++  LIN   +K
Sbjct: 45  FETSHKHPGAGEWVEGFQTSHKISIRATDSADYSMNLLPTKERPELNPVLSALINEDVMK 104

Query: 622 CLQA-RGVEE 648
            ++A R +EE
Sbjct: 105 SIEAKRAIEE 114


>AE014297-1796|AAF55017.1|  632|Drosophila melanogaster CG12402-PA
           protein.
          Length = 632

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = -3

Query: 164 TLLNLF*DLRQSFVIRNNDCTVIVLQVSVHHAPAFPHS--EFVSCGL 30
           T+LN+  +L++  V+  ++CT + LQ S+HH  A  H+  + ++C +
Sbjct: 563 TVLNIVSNLKRLRVLNLSNCTKLTLQ-SIHHILAHGHNLVQLIACSI 608


>BT015250-1|AAT94479.1| 1246|Drosophila melanogaster LP19005p
           protein.
          Length = 1246

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 296 YWSSTRPDRIFSCRLDGRLR 237
           YW+ T  DRI  CRLDG  R
Sbjct: 492 YWTDTVTDRIEVCRLDGTAR 511


>AY005815-1|AAF91072.1| 1678|Drosophila melanogaster arrow protein.
          Length = 1678

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 296 YWSSTRPDRIFSCRLDGRLR 237
           YW+ T  DRI  CRLDG  R
Sbjct: 492 YWTDTVTDRIEVCRLDGTAR 511


>AF223365-1|AAF28358.1| 1678|Drosophila melanogaster LDL-related
           protein LRP6 protein.
          Length = 1678

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 296 YWSSTRPDRIFSCRLDGRLR 237
           YW+ T  DRI  CRLDG  R
Sbjct: 492 YWTDTVXDRIEVCRLDGTAR 511


>AE013599-1719|AAF58373.2| 1678|Drosophila melanogaster CG5912-PA
           protein.
          Length = 1678

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 296 YWSSTRPDRIFSCRLDGRLR 237
           YW+ T  DRI  CRLDG  R
Sbjct: 492 YWTDTVTDRIEVCRLDGTAR 511


>AF172329-1|AAF02618.1| 3579|Drosophila melanogaster starry night
            protein protein.
          Length = 3579

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 1/70 (1%)
 Frame = +2

Query: 98   LRCSRYCESRSSGA-GLRTGSAECDNAALATRFKSLHKSPLE*FHGAAEVVRQAGRRIFC 274
            L C  Y     SGA    TG  EC    +  R  S      E      EVV  A  R F 
Sbjct: 2093 LSCDCYSIGSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVTLSGCEVVYDACPRSFA 2152

Query: 275  PAVWNSNSPV 304
              VW   +P+
Sbjct: 2153 GGVWWPRTPL 2162


>AE013599-1158|AAF58763.4| 3574|Drosophila melanogaster CG11895-PA
            protein.
          Length = 3574

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 1/70 (1%)
 Frame = +2

Query: 98   LRCSRYCESRSSGA-GLRTGSAECDNAALATRFKSLHKSPLE*FHGAAEVVRQAGRRIFC 274
            L C  Y     SGA    TG  EC    +  R  S      E      EVV  A  R F 
Sbjct: 2093 LSCDCYSIGSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVTLSGCEVVYDACPRSFA 2152

Query: 275  PAVWNSNSPV 304
              VW   +P+
Sbjct: 2153 GGVWWPRTPL 2162


>AB028498-1|BAA84069.1| 3575|Drosophila melanogaster Flamingo protein.
          Length = 3575

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 1/70 (1%)
 Frame = +2

Query: 98   LRCSRYCESRSSGA-GLRTGSAECDNAALATRFKSLHKSPLE*FHGAAEVVRQAGRRIFC 274
            L C  Y     SGA    TG  EC    +  R  S      E      EVV  A  R F 
Sbjct: 2094 LSCDCYSIGSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVTLSGCEVVYDACPRSFA 2153

Query: 275  PAVWNSNSPV 304
              VW   +P+
Sbjct: 2154 GGVWWPRTPL 2163


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,646,526
Number of Sequences: 53049
Number of extensions: 763288
Number of successful extensions: 2503
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 2351
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2500
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3170136354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -