SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-P...    28   8.9  
AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-P...    28   8.9  
AB277547-1|BAF51959.1| 1039|Drosophila melanogaster serine/threo...    28   8.9  

>AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-PE,
           isoform E protein.
          Length = 1039

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 13/51 (25%), Positives = 23/51 (45%)
 Frame = +2

Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538
           ++ +CL   SG   +HS   + + +   +IL+ D  V      G   + CP
Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177


>AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-PD,
           isoform D protein.
          Length = 1039

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 13/51 (25%), Positives = 23/51 (45%)
 Frame = +2

Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538
           ++ +CL   SG   +HS   + + +   +IL+ D  V      G   + CP
Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177


>AB277547-1|BAF51959.1| 1039|Drosophila melanogaster
           serine/threonine protein kinaseTAO1 alpha protein.
          Length = 1039

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 13/51 (25%), Positives = 23/51 (45%)
 Frame = +2

Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538
           ++ +CL   SG   +HS   + + +   +IL+ D  V      G   + CP
Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,295,252
Number of Sequences: 53049
Number of extensions: 445116
Number of successful extensions: 1032
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1006
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1032
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2559155400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -