SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U25344-1|AAB02171.1|  615|Drosophila melanogaster angiotensin co...    75   9e-14
AY061129-1|AAL28677.1|  615|Drosophila melanogaster LD11258p pro...    75   9e-14
AE014134-2427|AAN10856.1|  615|Drosophila melanogaster CG8827-PB...    75   9e-14
AE014134-2426|AAF53353.2|  615|Drosophila melanogaster CG8827-PA...    75   9e-14
X96913-1|CAA65632.1|  630|Drosophila melanogaster metallopeptida...    74   2e-13
AY051750-1|AAK93174.1|  630|Drosophila melanogaster LD28328p pro...    74   2e-13
AE014134-1537|AAF52693.1|  630|Drosophila melanogaster CG10593-P...    74   2e-13
U34599-1|AAC46902.1|  615|Drosophila melanogaster Race protein.        71   1e-12
AY075532-1|AAL68339.1|  844|Drosophila melanogaster RH06639p pro...    56   6e-08
AE014134-2430|ABC65898.1|  844|Drosophila melanogaster CG17988-P...    56   6e-08
AE014134-2428|AAF53354.1|  611|Drosophila melanogaster CG16869-P...    55   8e-08
AY119170-1|AAM51030.1|  620|Drosophila melanogaster RH49114p pro...    33   0.37 
AE013599-768|AAF59002.2|  609|Drosophila melanogaster CG8196-PA ...    33   0.37 
BT022721-1|AAY55137.1|  115|Drosophila melanogaster RH10188p pro...    31   1.1  
AE014298-2676|AAN09461.1|  115|Drosophila melanogaster CG32553-P...    31   1.1  
AY047543-1|AAK77275.1|  561|Drosophila melanogaster GH05723p pro...    30   3.4  
AE014298-808|AAF46094.1|  674|Drosophila melanogaster CG3033-PA ...    30   3.4  

>U25344-1|AAB02171.1|  615|Drosophila melanogaster angiotensin
           converting enzymeprecursor protein.
          Length = 615

 Score = 74.9 bits (176), Expect = 9e-14
 Identities = 31/59 (52%), Positives = 45/59 (76%)
 Frame = +2

Query: 509 LMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           L+ T+S MESN+A  K+C YK+ +KCDL+L+PEI E+ S S+D EEL + W E+++ AG
Sbjct: 116 LLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAG 174



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 LDKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDF 437
           L+K    R N  + A W Y SNIT ENE+K  +   EL++  K    +T  + W+ +Q  
Sbjct: 32  LNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSE 91

Query: 438 TLRRMFKKYSQLGVAALPDDKF 503
            L+R FK  ++LG AALP+D +
Sbjct: 92  DLKRQFKALTKLGYAALPEDDY 113


>AY061129-1|AAL28677.1|  615|Drosophila melanogaster LD11258p
           protein.
          Length = 615

 Score = 74.9 bits (176), Expect = 9e-14
 Identities = 31/59 (52%), Positives = 45/59 (76%)
 Frame = +2

Query: 509 LMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           L+ T+S MESN+A  K+C YK+ +KCDL+L+PEI E+ S S+D EEL + W E+++ AG
Sbjct: 116 LLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAG 174



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 LDKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDF 437
           L+K    R N  + A W Y SNIT ENE+K  +   EL++  K    +T  + W+ +Q  
Sbjct: 32  LNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSE 91

Query: 438 TLRRMFKKYSQLGVAALPDDKF 503
            L+R FK  ++LG AALP+D +
Sbjct: 92  DLKRQFKALTKLGYAALPEDDY 113


>AE014134-2427|AAN10856.1|  615|Drosophila melanogaster CG8827-PB,
           isoform B protein.
          Length = 615

 Score = 74.9 bits (176), Expect = 9e-14
 Identities = 31/59 (52%), Positives = 45/59 (76%)
 Frame = +2

Query: 509 LMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           L+ T+S MESN+A  K+C YK+ +KCDL+L+PEI E+ S S+D EEL + W E+++ AG
Sbjct: 116 LLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAG 174



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 LDKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDF 437
           L+K    R N  + A W Y SNIT ENE+K  +   EL++  K    +T  + W+ +Q  
Sbjct: 32  LNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSE 91

Query: 438 TLRRMFKKYSQLGVAALPDDKF 503
            L+R FK  ++LG AALP+D +
Sbjct: 92  DLKRQFKALTKLGYAALPEDDY 113


>AE014134-2426|AAF53353.2|  615|Drosophila melanogaster CG8827-PA,
           isoform A protein.
          Length = 615

 Score = 74.9 bits (176), Expect = 9e-14
 Identities = 31/59 (52%), Positives = 45/59 (76%)
 Frame = +2

Query: 509 LMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           L+ T+S MESN+A  K+C YK+ +KCDL+L+PEI E+ S S+D EEL + W E+++ AG
Sbjct: 116 LLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAG 174



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 LDKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDF 437
           L+K    R N  + A W Y SNIT ENE+K  +   EL++  K    +T  + W+ +Q  
Sbjct: 32  LNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSE 91

Query: 438 TLRRMFKKYSQLGVAALPDDKF 503
            L+R FK  ++LG AALP+D +
Sbjct: 92  DLKRQFKALTKLGYAALPEDDY 113


>X96913-1|CAA65632.1|  630|Drosophila melanogaster metallopeptidase
           protein.
          Length = 630

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 31/60 (51%), Positives = 40/60 (66%)
 Frame = +2

Query: 506 SLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +L   +S M++NYATA +CSY N S C L+LEP I E  S S+DP EL   W EWH+ +G
Sbjct: 124 ALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHDKSG 183


>AY051750-1|AAK93174.1|  630|Drosophila melanogaster LD28328p
           protein.
          Length = 630

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 31/60 (51%), Positives = 40/60 (66%)
 Frame = +2

Query: 506 SLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +L   +S M++NYATA +CSY N S C L+LEP I E  S S+DP EL   W EWH+ +G
Sbjct: 124 ALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHDKSG 183


>AE014134-1537|AAF52693.1|  630|Drosophila melanogaster CG10593-PA
           protein.
          Length = 630

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 31/60 (51%), Positives = 40/60 (66%)
 Frame = +2

Query: 506 SLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           +L   +S M++NYATA +CSY N S C L+LEP I E  S S+DP EL   W EWH+ +G
Sbjct: 124 ALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHDKSG 183


>U34599-1|AAC46902.1|  615|Drosophila melanogaster Race protein.
          Length = 615

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 44/59 (74%)
 Frame = +2

Query: 509 LMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           L+ T+S MESN+A  K+C YK+ +K DL+L+PEI E+ S S+D EEL + W E+++ AG
Sbjct: 116 LLDTLSAMESNFAKVKVCDYKDSTKSDLALDPEIEEVISKSRDHEELAYYWREFYDKAG 174



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/82 (36%), Positives = 45/82 (54%)
 Frame = +3

Query: 258 LDKATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDF 437
           L+K    R N  + A     SNIT ENE+K  +   EL++  K    +T  + W+ +Q  
Sbjct: 32  LNKELAKRTNVETEAAGPMRSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSE 91

Query: 438 TLRRMFKKYSQLGVAALPDDKF 503
            L+R FK  ++LG AALP+D +
Sbjct: 92  DLKRQFKALTKLGYAALPEDDY 113


>AY075532-1|AAL68339.1|  844|Drosophila melanogaster RH06639p
           protein.
          Length = 844

 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 23/57 (40%), Positives = 38/57 (66%)
 Frame = +2

Query: 515 RTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           R ++ M   Y +A+IC+Y+   +CDL   P++ +I + S+D +EL+H WVE+H  AG
Sbjct: 306 RLLNEMLFLYNSAEICAYQQPFQCDLHYIPQLKDIMAKSRDWDELQHTWVEYHRKAG 362


>AE014134-2430|ABC65898.1|  844|Drosophila melanogaster CG17988-PB
           protein.
          Length = 844

 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 23/57 (40%), Positives = 38/57 (66%)
 Frame = +2

Query: 515 RTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           R ++ M   Y +A+IC+Y+   +CDL   P++ +I + S+D +EL+H WVE+H  AG
Sbjct: 306 RLLNEMLFLYNSAEICAYQQPFQCDLHYIPQLKDIMAKSRDWDELQHTWVEYHRKAG 362


>AE014134-2428|AAF53354.1|  611|Drosophila melanogaster CG16869-PA
           protein.
          Length = 611

 Score = 55.2 bits (127), Expect = 8e-08
 Identities = 22/64 (34%), Positives = 33/64 (51%)
 Frame = +2

Query: 494 RQIPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWH 673
           R +  +    S M  NY   K+C+YK    C L L PE+  I   S+D +E+++ W EW 
Sbjct: 111 RDLKLVYALASSMSDNYHNVKLCAYKQPGNCTLRLIPEVQSIVQGSRDLDEIEYYWFEWR 170

Query: 674 NAAG 685
           +  G
Sbjct: 171 SRTG 174


>AY119170-1|AAM51030.1|  620|Drosophila melanogaster RH49114p
           protein.
          Length = 620

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 572 NESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHN 676
           NE    L+  P+I +I  +S+D +ELK+ W  W +
Sbjct: 145 NEDDSPLAYFPDIQKIVQSSKDADELKYYWEAWRD 179


>AE013599-768|AAF59002.2|  609|Drosophila melanogaster CG8196-PA
           protein.
          Length = 609

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 572 NESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHN 676
           NE    L+  P+I +I  +S+D +ELK+ W  W +
Sbjct: 145 NEDDSPLAYFPDIQKIVQSSKDADELKYYWEAWRD 179


>BT022721-1|AAY55137.1|  115|Drosophila melanogaster RH10188p
           protein.
          Length = 115

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +1

Query: 235 EAREYMLIW--TKRPA*GRTGPA*PNGSTPRISRRRTKRNRYKLTWSSPVKRKQ 390
           +AR  +L+   T  P  GR  PA P+ + P  + R TKR R    W++P  R++
Sbjct: 55  QARHVLLLRPATSEPRMGRRTPASPSLAAP--TTRATKRRRVNNVWAAPESRQR 106


>AE014298-2676|AAN09461.1|  115|Drosophila melanogaster CG32553-PA
           protein.
          Length = 115

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +1

Query: 235 EAREYMLIW--TKRPA*GRTGPA*PNGSTPRISRRRTKRNRYKLTWSSPVKRKQ 390
           +AR  +L+   T  P  GR  PA P+ + P  + R TKR R    W++P  R++
Sbjct: 55  QARHMLLLRPATSEPRMGRRTPASPSLAAP--TTRATKRRRVNNVWAAPESRQR 106


>AY047543-1|AAK77275.1|  561|Drosophila melanogaster GH05723p
           protein.
          Length = 561

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%)
 Frame = +2

Query: 284 EQGQLSRMGVHLEYHEGERREIDTNS----PGALPSRESSLGGDQDVRVAGLPGFHV 442
           EQ QL        YH+G+R E+D +     PG LP+R  SL    ++ V  L   HV
Sbjct: 191 EQEQLGMQAWLEAYHDGDR-ELDLSKAYLRPGNLPARAGSLQAALNIEVQDLEIDHV 246


>AE014298-808|AAF46094.1|  674|Drosophila melanogaster CG3033-PA
           protein.
          Length = 674

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%)
 Frame = +2

Query: 284 EQGQLSRMGVHLEYHEGERREIDTNS----PGALPSRESSLGGDQDVRVAGLPGFHV 442
           EQ QL        YH+G+R E+D +     PG LP+R  SL    ++ V  L   HV
Sbjct: 191 EQEQLGMQAWLEAYHDGDR-ELDLSKAYLRPGNLPARAGSLQAALNIEVQDLEIDHV 246


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,167,540
Number of Sequences: 53049
Number of extensions: 607342
Number of successful extensions: 1882
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1786
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1878
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3005453946
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -