SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY094914-1|AAM11267.1|  275|Drosophila melanogaster RH19667p pro...   108   7e-24
AE014298-1410|AAF46554.1|  275|Drosophila melanogaster CG2974-PA...   108   7e-24
AY070614-1|AAL48085.1|  605|Drosophila melanogaster RE71584p pro...    29   4.0  
AE014297-1557|AAF54839.1|  635|Drosophila melanogaster CG18616-P...    29   4.0  
AY118900-1|AAM50760.1|  425|Drosophila melanogaster LD10016p pro...    29   7.0  
AE014298-1224|AAF46408.1|  425|Drosophila melanogaster CG2004-PA...    29   7.0  
U76378-1|AAB18789.1| 1150|Drosophila melanogaster LK6 protein ki...    28   9.3  
AE014297-1372|AAF54694.1| 1142|Drosophila melanogaster CG17342-P...    28   9.3  

>AY094914-1|AAM11267.1|  275|Drosophila melanogaster RH19667p
           protein.
          Length = 275

 Score =  108 bits (259), Expect = 7e-24
 Identities = 49/68 (72%), Positives = 55/68 (80%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           +YLNQ EA A+DQ+LF +YKFSVDQLMELAGLS A A+AK FP   H   L+ CGPGNNG
Sbjct: 49  KYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNNG 108

Query: 485 GDGLVAAR 508
           GDGLVAAR
Sbjct: 109 GDGLVAAR 116



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 16/44 (36%), Positives = 28/44 (63%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLPDTK 639
           ++ L GY  +++YPK T KPL+ENL  QC + ++  + + P  +
Sbjct: 117 HLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVE 160


>AE014298-1410|AAF46554.1|  275|Drosophila melanogaster CG2974-PA
           protein.
          Length = 275

 Score =  108 bits (259), Expect = 7e-24
 Identities = 49/68 (72%), Positives = 55/68 (80%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           +YLNQ EA A+DQ+LF +YKFSVDQLMELAGLS A A+AK FP   H   L+ CGPGNNG
Sbjct: 49  KYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNNG 108

Query: 485 GDGLVAAR 508
           GDGLVAAR
Sbjct: 109 GDGLVAAR 116



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 16/44 (36%), Positives = 28/44 (63%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLPDTK 639
           ++ L GY  +++YPK T KPL+ENL  QC + ++  + + P  +
Sbjct: 117 HLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVE 160


>AY070614-1|AAL48085.1|  605|Drosophila melanogaster RE71584p
           protein.
          Length = 605

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 22/87 (25%), Positives = 39/87 (44%)
 Frame = +2

Query: 302 TRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNN 481
           T  LN++EA  LD   + +YK ++      +  +  +A+    PPS  +++ +V  PG  
Sbjct: 157 TNQLNRAEAF-LD---YLQYKLNLVATAPSSNAAEEAAVVGTAPPSAATNSSVVASPGGA 212

Query: 482 GGDGLVAARICSCSDTMYRYIILNAHP 562
             +G V     S        ++LN  P
Sbjct: 213 AVEGAVPGLGGSLQLLQLITLVLNRKP 239


>AE014297-1557|AAF54839.1|  635|Drosophila melanogaster CG18616-PA
           protein.
          Length = 635

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 22/87 (25%), Positives = 39/87 (44%)
 Frame = +2

Query: 302 TRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNN 481
           T  LN++EA  LD   + +YK ++      +  +  +A+    PPS  +++ +V  PG  
Sbjct: 157 TNQLNRAEAF-LD---YLQYKLNLVATAPSSNAAEEAAVVGTAPPSAATNSSVVASPGGA 212

Query: 482 GGDGLVAARICSCSDTMYRYIILNAHP 562
             +G V     S        ++LN  P
Sbjct: 213 AVEGAVPGLGGSLQLLQLITLVLNRKP 239


>AY118900-1|AAM50760.1|  425|Drosophila melanogaster LD10016p
           protein.
          Length = 425

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 109 GFK*NIILTDIWNQTTYLLLVKEKQ*KNLLK 201
           G K N ILTDIWN T +    K+++  ++ K
Sbjct: 386 GIKENAILTDIWNITPFKESAKQQRLADIFK 416


>AE014298-1224|AAF46408.1|  425|Drosophila melanogaster CG2004-PA
           protein.
          Length = 425

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 109 GFK*NIILTDIWNQTTYLLLVKEKQ*KNLLK 201
           G K N ILTDIWN T +    K+++  ++ K
Sbjct: 386 GIKENAILTDIWNITPFKESAKQQRLADIFK 416


>U76378-1|AAB18789.1| 1150|Drosophila melanogaster LK6 protein
           kinase protein.
          Length = 1150

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 218 VRECSNIACSKTDNIGTMTSSMNQCNTVTRYLNQ 319
           +R  S I+CS TDN  + + S  Q N +TRY ++
Sbjct: 34  IRSGSGISCSNTDNSCSQSQSDGQ-NELTRYSSE 66


>AE014297-1372|AAF54694.1| 1142|Drosophila melanogaster CG17342-PA,
           isoform A protein.
          Length = 1142

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 218 VRECSNIACSKTDNIGTMTSSMNQCNTVTRYLNQ 319
           +R  S I+CS TDN  + + S  Q N +TRY ++
Sbjct: 34  IRSGSGISCSNTDNSCSQSQSDGQ-NELTRYSSE 66


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,840,102
Number of Sequences: 53049
Number of extensions: 595006
Number of successful extensions: 1374
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1345
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1374
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2682985500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -