SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock pro...   177   1e-44
BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p pro...   177   1e-44
AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD...   177   1e-44
AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC...   177   1e-44
AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB...   177   1e-44
AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA...   177   1e-44
BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p pro...   130   2e-30
BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p pro...   130   2e-30
BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p pro...   130   2e-30
BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p pro...   130   2e-30
AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb prot...   130   2e-30
AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock p...   130   2e-30
AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock p...   130   2e-30
AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA...   130   2e-30
AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-P...   130   2e-30
AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA...   130   2e-30
AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-P...   130   2e-30
AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-P...   130   2e-30
AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-P...   130   2e-30
AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock p...   129   3e-30
J01103-1|AAA28640.1|  643|Drosophila melanogaster protein ( D.me...   128   6e-30
AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock p...   128   6e-30
AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock p...   128   6e-30
AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock p...   128   6e-30
AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb prot...   128   8e-30
AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb prot...   128   8e-30
AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock p...   127   1e-29
L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock pro...   127   1e-29
BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p pro...   127   1e-29
AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p pro...   127   1e-29
AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock p...   127   1e-29
AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock p...   127   1e-29
AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA...   127   1e-29
AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA...   127   1e-29
AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock p...   126   2e-29
M36114-1|AAA28627.1|  651|Drosophila melanogaster protein ( D.me...   125   4e-29
L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock pro...   125   4e-29
BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p pro...   125   4e-29
AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p pro...   125   4e-29
AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF...   125   4e-29
AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE...   125   4e-29
AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD...   125   4e-29
AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC...   125   4e-29
AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB...   125   4e-29
AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA...   125   4e-29
BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p pro...   120   1e-27
AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA...   120   1e-27
J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1...   119   3e-27
J01085-1|AAA28629.1|   68|Drosophila melanogaster protein ( Dros...   108   5e-24
BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p pro...   108   5e-24
AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock p...   108   7e-24
AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock p...   108   7e-24
AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock p...   108   7e-24
K01297-1|AAA28630.1|   68|Drosophila melanogaster protein ( D.me...   101   8e-22
AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock p...    97   2e-20
L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock pro...    94   1e-19
AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p pro...    94   1e-19
AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA...    94   1e-19
AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock pr...    79   7e-15
V00213-1|CAA23495.1|  149|Drosophila melanogaster protein ( Dros...    78   1e-14
AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p pro...    78   1e-14
AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC...    78   1e-14
AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB...    78   1e-14
AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA...    78   1e-14
J02569-1|AAA28631.1|  104|Drosophila melanogaster protein ( D.me...    71   1e-12
BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p pro...    40   0.004
AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p pro...    40   0.004
AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1 pr...    40   0.004
AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA ...    40   0.004
AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD...    40   0.004
AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC...    40   0.004
AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p pro...    39   0.005
AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.     39   0.005
AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA...    39   0.005

>L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock
           protein cognate 72 protein.
          Length = 656

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p
           protein.
          Length = 655

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD,
           isoform D protein.
          Length = 656

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC,
           isoform C protein.
          Length = 656

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB,
           isoform B protein.
          Length = 656

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA,
           isoform A protein.
          Length = 656

 Score =  177 bits (430), Expect = 1e-44
 Identities = 82/90 (91%), Positives = 86/90 (95%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           L   ++EKDK++GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT DGERL
Sbjct: 17  LGEEKKEKDKELGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERL 76

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           IGDAAKNQLTTNPENTVFDAKRLIGREWSD
Sbjct: 77  IGDAAKNQLTTNPENTVFDAKRLIGREWSD 106



 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQHD+KFFPFKVVEKNSKPH+ V TSQG KVFAPEEISAMVL
Sbjct: 109 VQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVL 150


>BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p
           protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVIDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-PA
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-PA
           protein.
          Length = 641

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-PA
           protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-PA
           protein.
          Length = 642

 Score =  130 bits (313), Expect = 2e-30
 Identities = 61/75 (81%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  129 bits (312), Expect = 3e-30
 Identities = 61/75 (81%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR + D
Sbjct: 63  TVFDAKRLIGRRYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>J01103-1|AAA28640.1|  643|Drosophila melanogaster protein (
           D.melanogaster heatshock protein 70 genes, locus 87A7,
           seg. 2. (partial proximalgene, spacer region and
           complete distal gene). ).
          Length = 643

 Score =  128 bits (309), Expect = 6e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIG+ AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGEPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  128 bits (309), Expect = 6e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT + ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  128 bits (309), Expect = 6e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT + ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  128 bits (309), Expect = 6e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT + ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  128 bits (308), Expect = 8e-30
 Identities = 60/75 (80%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRL GR++ D
Sbjct: 63  TVFDAKRLTGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  128 bits (308), Expect = 8e-30
 Identities = 60/75 (80%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFD KRLIGR++ D
Sbjct: 63  TVFDPKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  127 bits (307), Expect = 1e-29
 Identities = 60/75 (80%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D  RLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSARLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 641

 Score =  127 bits (306), Expect = 1e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 66  TIFDAKRLIGRRFDD 80



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/43 (48%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 82  TVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 124


>BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p
           protein.
          Length = 680

 Score =  127 bits (306), Expect = 1e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 46  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 104

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 105 TIFDAKRLIGRRFDD 119



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/43 (48%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 121 TVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 163


>AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p
           protein.
          Length = 635

 Score =  127 bits (306), Expect = 1e-29
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++ G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 4   IGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNPKN 62

Query: 461 TVFDAKRLIGREWSD 505
           +VFDAKRLIGR + D
Sbjct: 63  SVFDAKRLIGRRFDD 77



 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q D+K +PFKV+  N KP + V+    +K F+PEEIS+MVL
Sbjct: 80  IQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVL 121


>AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  127 bits (306), Expect = 1e-29
 Identities = 60/75 (80%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAK LIGR++ D
Sbjct: 63  TVFDAKGLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock
           protein 68 protein.
          Length = 635

 Score =  127 bits (306), Expect = 1e-29
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++ G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 4   IGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNPKN 62

Query: 461 TVFDAKRLIGREWSD 505
           +VFDAKRLIGR + D
Sbjct: 63  SVFDAKRLIGRRFDD 77



 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q D+K +PFKV+  N KP + V+    +K F+PEEIS+MVL
Sbjct: 80  IQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVL 121


>AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA
           protein.
          Length = 635

 Score =  127 bits (306), Expect = 1e-29
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++ G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 4   IGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNPKN 62

Query: 461 TVFDAKRLIGREWSD 505
           +VFDAKRLIGR + D
Sbjct: 63  SVFDAKRLIGRRFDD 77



 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q D+K +PFKV+  N KP + V+    +K F+PEEIS+MVL
Sbjct: 80  IQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVL 121


>AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA,
           isoform A protein.
          Length = 641

 Score =  127 bits (306), Expect = 1e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 66  TIFDAKRLIGRRFDD 80



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/43 (48%), Positives = 30/43 (69%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 82  TVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 124


>AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  126 bits (305), Expect = 2e-29
 Identities = 60/75 (80%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  N  N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNSRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>M36114-1|AAA28627.1|  651|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 4 (hsc4) gene, exon 2.
           ).
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p
           protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p
           protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF,
           isoform F protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE,
           isoform E protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD,
           isoform D protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC,
           isoform C protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB,
           isoform B protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA,
           isoform A protein.
          Length = 651

 Score =  125 bits (302), Expect = 4e-29
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP  
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQ 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 66  TIFDAKRLIGRKFDD 80



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF+VV  + KP ++V      K F PEEIS+MVL
Sbjct: 83  VQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVL 124


>BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p
           protein.
          Length = 633

 Score =  120 bits (290), Expect = 1e-27
 Identities = 57/76 (75%), Positives = 66/76 (86%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++N +VEIIANDQGNR TPSYVAF +  ERLIGD AKNQ+  N +N
Sbjct: 7   IGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNET-ERLIGDPAKNQVAMNAKN 65

Query: 461 TVFDAKRLIGREWSDQ 508
           TVFDAKRLIGR++ D+
Sbjct: 66  TVFDAKRLIGRKFDDK 81



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q D+K +PFKV+ +  KP ++V+     K FAPEEIS+MVL
Sbjct: 83  IQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEISSMVL 124


>AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA
           protein.
          Length = 633

 Score =  120 bits (290), Expect = 1e-27
 Identities = 57/76 (75%), Positives = 66/76 (86%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++N +VEIIANDQGNR TPSYVAF +  ERLIGD AKNQ+  N +N
Sbjct: 7   IGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNET-ERLIGDPAKNQVAMNAKN 65

Query: 461 TVFDAKRLIGREWSDQ 508
           TVFDAKRLIGR++ D+
Sbjct: 66  TVFDAKRLIGRKFDDK 81



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q D+K +PFKV+ +  KP ++V+     K FAPEEIS+MVL
Sbjct: 83  IQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEISSMVL 124


>J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1
           protein protein.
          Length = 641

 Score =  119 bits (287), Expect = 3e-27
 Identities = 57/75 (76%), Positives = 64/75 (85%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEI A DQGNR TPSYVAFT D ERL G+ AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEINAYDQGNRTTPSYVAFT-DSERLNGEPAKNQVAMNPRN 62

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 63  TVFDAKRLIGRKYDD 77



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFKVV    KP + V+     K FAPEEIS+MVL
Sbjct: 78  PKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121


>J01085-1|AAA28629.1|   68|Drosophila melanogaster protein (
           Drosophila melanogasterheat shock cognate (hsc70) gene
           (locus 70C), exon 1. ).
          Length = 68

 Score =  108 bits (260), Expect = 5e-24
 Identities = 49/63 (77%), Positives = 57/63 (90%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 65

Query: 461 TVF 469
           T+F
Sbjct: 66  TIF 68


>BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p
           protein.
          Length = 73

 Score =  108 bits (260), Expect = 5e-24
 Identities = 49/63 (77%), Positives = 57/63 (90%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 65

Query: 461 TVF 469
           T+F
Sbjct: 66  TIF 68


>AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 64

 Score =  108 bits (259), Expect = 7e-24
 Identities = 51/62 (82%), Positives = 55/62 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TV 466
           TV
Sbjct: 63  TV 64


>AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  108 bits (259), Expect = 7e-24
 Identities = 51/62 (82%), Positives = 55/62 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TV 466
           TV
Sbjct: 63  TV 64


>AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  108 bits (259), Expect = 7e-24
 Identities = 51/62 (82%), Positives = 55/62 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ+  NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQVAMNPRN 62

Query: 461 TV 466
           TV
Sbjct: 63  TV 64


>K01297-1|AAA28630.1|   68|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 87D:
           exon 2. (partial). ).
          Length = 68

 Score =  101 bits (242), Expect = 8e-22
 Identities = 48/63 (76%), Positives = 54/63 (85%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++N +VEIIANDQGNR TPSYVAF +  ERLIGD AKNQ+  N +N
Sbjct: 7   IGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNET-ERLIGDPAKNQVAMNAKN 65

Query: 461 TVF 469
           TVF
Sbjct: 66  TVF 68


>AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock
           protein hsp70Bb protein.
          Length = 55

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 46/53 (86%), Positives = 49/53 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQ 439
           IGIDLGTTYSCVGVY++G+VEIIANDQGNR TPSYVAFT D ERLIGD AKNQ
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFT-DSERLIGDPAKNQ 55


>L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock
           protein cognate 71 protein.
          Length = 687

 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 44/78 (56%), Positives = 55/78 (70%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGTT SC+ V +  + ++I N +G R TPS+VAFT+DGERL+G  AK Q  TN
Sbjct: 52  GAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTN 111

Query: 452 PENTVFDAKRLIGREWSD 505
             NT +  KRLIGR + D
Sbjct: 112 SANTFYATKRLIGRRFDD 129


>AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p
           protein.
          Length = 686

 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 44/78 (56%), Positives = 55/78 (70%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGTT SC+ V +  + ++I N +G R TPS+VAFT+DGERL+G  AK Q  TN
Sbjct: 52  GAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTN 111

Query: 452 PENTVFDAKRLIGREWSD 505
             NT +  KRLIGR + D
Sbjct: 112 SANTFYATKRLIGRRFDD 129


>AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA
           protein.
          Length = 686

 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 44/78 (56%), Positives = 55/78 (70%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGTT SC+ V +  + ++I N +G R TPS+VAFT+DGERL+G  AK Q  TN
Sbjct: 52  GAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTN 111

Query: 452 PENTVFDAKRLIGREWSD 505
             NT +  KRLIGR + D
Sbjct: 112 SANTFYATKRLIGRRFDD 129


>AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock
           protein cognate 70Cb protein.
          Length = 804

 Score = 78.6 bits (185), Expect = 7e-15
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGEIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>V00213-1|CAA23495.1|  149|Drosophila melanogaster protein (
           Drosophila melanogastergene coding for heat shock
           protein 70. ).
          Length = 149

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 45/103 (43%), Positives = 57/103 (55%), Gaps = 2/103 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGVY++G+VEIIANDQ     P    +             N+   NP N
Sbjct: 4   IGIDLGTTYSCVGVYQHGKVEIIANDQAT--APRRPTWLSQIRNAXXATNNNRWPLNPSN 61

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLK--RTANLMFKYK 583
           T F AKRLIGR++ D      +   P ++ K  R A +  +YK
Sbjct: 62  TAFHAKRLIGRKYDDPKIAEDMKHWPFKAGKRRRKAQIGVEYK 104



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +  D+K +PFK  ++  K  + V+     K FAPEEIS+MVL
Sbjct: 77  PKIAEDMKHWPFKAGKRRRKAQIGVEYKGESKRFAPEEISSMVL 120


>AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p
           protein.
          Length = 804

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC,
           isoform C protein.
          Length = 804

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB,
           isoform B protein.
          Length = 804

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA,
           isoform A protein.
          Length = 804

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>J02569-1|AAA28631.1|  104|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 88E
           (partial). ).
          Length = 104

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 42/75 (56%), Positives = 48/75 (64%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGVY                    VAFT D ERLIGDAAKN++  NP  
Sbjct: 7   VGIDLGTTYSCVGVY--------------------VAFT-DTERLIGDAAKNEVAMNPTQ 45

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR++ D
Sbjct: 46  TIFDAKRLIGRKFDD 60



 Score = 28.3 bits (60), Expect = 9.2
 Identities = 9/24 (37%), Positives = 17/24 (70%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQ 576
           P ++ D+K +PF+VV  + KP ++
Sbjct: 81  PKIESDMKHWPFEVVSADGKPKIE 104


>BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p
           protein.
          Length = 555

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +1

Query: 523 VKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 38


>AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p
           protein.
          Length = 923

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V+ +DLG+ +  VGV   G  +EI  N +  R TP+ +AF +DG R IG+ A+     +P
Sbjct: 22  VMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAF-RDGTRTIGEDAQTIGIKDP 80

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
            +       L+G+   + + ++     P
Sbjct: 81  NSAYGYLLDLLGKTIDNPIVDLYRKRFP 108


>AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1
           protein.
          Length = 923

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V+ +DLG+ +  VGV   G  +EI  N +  R TP+ +AF +DG R IG+ A+     +P
Sbjct: 22  VMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAF-RDGTRTIGEDAQTIGIKDP 80

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
            +       L+G+   + + ++     P
Sbjct: 81  NSAYGYLLDLLGKTIDNPIVDLYRKRFP 108


>AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA
           protein.
          Length = 923

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V+ +DLG+ +  VGV   G  +EI  N +  R TP+ +AF +DG R IG+ A+     +P
Sbjct: 22  VMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAF-RDGTRTIGEDAQTIGIKDP 80

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
            +       L+G+   + + ++     P
Sbjct: 81  NSAYGYLLDLLGKTIDNPIVDLYRKRFP 108


>AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD,
           isoform D protein.
          Length = 555

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +1

Query: 523 VKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 38


>AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC,
           isoform C protein.
          Length = 555

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +1

Query: 523 VKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +K +PF+V  +N KP ++V+     K F PEE+S+MVL
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVL 38


>AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p
           protein.
          Length = 513

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 284 GIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           GI +G +  C+  V  +G+ E+IAN QG+R++ + + +    E   G  AK ++   P  
Sbjct: 6   GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQ 65

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSS 535
            V  + +L+  +  ++L    LSS+
Sbjct: 66  AVAHSFQLL--QPKEELTEEKLSSA 88


>AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.
          Length = 46

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGER 412
           +VIGID G     V   ++G +E +AND   R T S+VAF  DG++
Sbjct: 2   SVIGIDFGNESCYVAARRSGEIETLANDYSLRATRSFVAF--DGKK 45


>AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA
           protein.
          Length = 513

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 284 GIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           GI +G +  C+  V  +G+ E+IAN QG+R++ + + +    E   G  AK ++   P  
Sbjct: 6   GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQ 65

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSS 535
            V  + +L+  +  ++L    LSS+
Sbjct: 66  AVAHSFQLL--QPKEELTEEKLSSA 88


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,033,722
Number of Sequences: 53049
Number of extensions: 643016
Number of successful extensions: 1900
Number of sequences better than 10.0: 155
Number of HSP's better than 10.0 without gapping: 1573
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1764
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -