SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT025042-1|ABE73213.1| 2313|Drosophila melanogaster LD27386p pro...    68   1e-11
AY050232-1|AAK84931.1| 1443|Drosophila melanogaster SD01656p pro...    68   1e-11
AE014298-1909|AAF48273.2| 2362|Drosophila melanogaster CG1716-PA...    68   1e-11
BT023925-1|ABB36429.1|  434|Drosophila melanogaster RE75106p pro...    30   3.1  
AE014296-872|AAF47918.1|  434|Drosophila melanogaster CG11357-PA...    30   3.1  

>BT025042-1|ABE73213.1| 2313|Drosophila melanogaster LD27386p protein.
          Length = 2313

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-SVEELVVTDSVRSKAKTFV 189
            L PYR      GRIT   D+K L  +L++ +  KE+++C  S   L  T+SV+ K+  F+
Sbjct: 2236 LRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFI 2295

Query: 190  KKYMAKFGPVYKRPPE 237
             +YM + GPVYK+P E
Sbjct: 2296 NQYMRQKGPVYKKPAE 2311


>AY050232-1|AAK84931.1| 1443|Drosophila melanogaster SD01656p protein.
          Length = 1443

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-SVEELVVTDSVRSKAKTFV 189
            L PYR      GRIT   D+K L  +L++ +  KE+++C  S   L  T+SV+ K+  F+
Sbjct: 1366 LRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFI 1425

Query: 190  KKYMAKFGPVYKRPPE 237
             +YM + GPVYK+P E
Sbjct: 1426 NQYMRQKGPVYKKPAE 1441


>AE014298-1909|AAF48273.2| 2362|Drosophila melanogaster CG1716-PA
            protein.
          Length = 2362

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-SVEELVVTDSVRSKAKTFV 189
            L PYR      GRIT   D+K L  +L++ +  KE+++C  S   L  T+SV+ K+  F+
Sbjct: 2285 LRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFI 2344

Query: 190  KKYMAKFGPVYKRPPE 237
             +YM + GPVYK+P E
Sbjct: 2345 NQYMRQKGPVYKKPAE 2360


>BT023925-1|ABB36429.1|  434|Drosophila melanogaster RE75106p
           protein.
          Length = 434

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +1

Query: 73  KHLAR-KLTHFVMLKE--LKHCRSVEELVVTDSVRSKAKTFVKKYMAKFGPVY 222
           K+LA   L  + ML++  L  CRSV    V  S RSK +   K+Y  +F P Y
Sbjct: 247 KYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEY 299


>AE014296-872|AAF47918.1|  434|Drosophila melanogaster CG11357-PA
           protein.
          Length = 434

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +1

Query: 73  KHLAR-KLTHFVMLKE--LKHCRSVEELVVTDSVRSKAKTFVKKYMAKFGPVY 222
           K+LA   L  + ML++  L  CRSV    V  S RSK +   K+Y  +F P Y
Sbjct: 247 KYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEY 299


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,630,842
Number of Sequences: 53049
Number of extensions: 576560
Number of successful extensions: 1374
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1322
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1371
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -