SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY094659-1|AAM11012.1|  197|Drosophila melanogaster AT23634p pro...    66   6e-11
AE014297-2249|AAF55348.1|  197|Drosophila melanogaster CG10326-P...    66   6e-11
AF218812-1|AAF32329.1|  558|Drosophila melanogaster putative cyt...    29   6.3  
AF218811-1|AAF32328.1|  558|Drosophila melanogaster putative cyt...    29   6.3  
AE014297-1594|AAF54873.1|  558|Drosophila melanogaster CG7340-PB...    29   6.3  

>AY094659-1|AAM11012.1|  197|Drosophila melanogaster AT23634p
           protein.
          Length = 197

 Score = 65.7 bits (153), Expect = 6e-11
 Identities = 23/95 (24%), Positives = 55/95 (57%)
 Frame = +3

Query: 207 KSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL 386
           K K +      ++  +  V+ WE+Q++   + G ++ +YL++W LDL+ +  ++++G+I 
Sbjct: 14  KLKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDLSLITLLSLLGVIS 73

Query: 387 NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSI 491
             +++  P++   ++G  +W G  E  FE++C  +
Sbjct: 74  ILLNYAFPMVSRLIFGGVNWDGDQEAKFEDVCGQV 108



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/57 (28%), Positives = 29/57 (50%)
 Frame = +2

Query: 509 LVIYIHSFYSLRDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXXXXWPGIQ 679
           LV++    ++ R ++ F+   +S+  L  +AWI + INN+            WPG+Q
Sbjct: 115 LVVWYEYLFNERKSTVFVI-VMSLGLLA-MAWIGAIINNLLLMYLATLLILMWPGLQ 169


>AE014297-2249|AAF55348.1|  197|Drosophila melanogaster CG10326-PA
           protein.
          Length = 197

 Score = 65.7 bits (153), Expect = 6e-11
 Identities = 23/95 (24%), Positives = 55/95 (57%)
 Frame = +3

Query: 207 KSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL 386
           K K +      ++  +  V+ WE+Q++   + G ++ +YL++W LDL+ +  ++++G+I 
Sbjct: 14  KLKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDLSLITLLSLLGVIS 73

Query: 387 NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSI 491
             +++  P++   ++G  +W G  E  FE++C  +
Sbjct: 74  ILLNYAFPMVSRLIFGGVNWDGDQEAKFEDVCGQV 108



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/57 (28%), Positives = 29/57 (50%)
 Frame = +2

Query: 509 LVIYIHSFYSLRDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXXXXWPGIQ 679
           LV++    ++ R ++ F+   +S+  L  +AWI + INN+            WPG+Q
Sbjct: 115 LVVWYEYLFNERKSTVFVI-VMSLGLLA-MAWIGAIINNLLLMYLATLLILMWPGLQ 169


>AF218812-1|AAF32329.1|  558|Drosophila melanogaster putative
           cytoplasmic aminopeptidaseprotein.
          Length = 558

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +3

Query: 186 RSGTASAKSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLL 329
           R+  A   S A F+++A  +  ++S+   + Q HP  I+G +  + LL
Sbjct: 11  RNHLARTYSSARFKKMATDVKFNESLGCSDPQTHPVLIIGQLRHLNLL 58


>AF218811-1|AAF32328.1|  558|Drosophila melanogaster putative
           cytoplasmic aminopeptidaseprotein.
          Length = 558

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +3

Query: 186 RSGTASAKSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLL 329
           R+  A   S A F+++A  +  ++S+   + Q HP  I+G +  + LL
Sbjct: 11  RNHLARTYSSARFKKMATDVKFNESLGCSDPQTHPVLIIGQLRHLNLL 58


>AE014297-1594|AAF54873.1|  558|Drosophila melanogaster CG7340-PB,
           isoform B protein.
          Length = 558

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +3

Query: 186 RSGTASAKSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLL 329
           R+  A   S A F+++A  +  ++S+   + Q HP  I+G +  + LL
Sbjct: 11  RNHLARTYSSARFKKMATDVKFNESLGCSDPQTHPVLIIGQLRHLNLL 58


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,967,878
Number of Sequences: 53049
Number of extensions: 626988
Number of successful extensions: 1596
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1596
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3170136354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -