SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT011369-1|AAR96161.1|  261|Drosophila melanogaster RE57333p pro...   154   9e-38
AE014296-2240|AAF49846.1|  261|Drosophila melanogaster CG11276-P...   154   9e-38
AE014296-2239|AAF49847.1|  261|Drosophila melanogaster CG11276-P...   154   9e-38
D16257-1|BAA03786.1|  261|Drosophila melanogaster ribosomal prot...   151   9e-37
BT021421-1|AAX33569.1| 1098|Drosophila melanogaster LD02690p pro...    32   0.63 
AY051840-1|AAK93264.1|  561|Drosophila melanogaster LD34444p pro...    32   0.63 
AE013599-2039|AAF58149.3| 1098|Drosophila melanogaster CG8155-PA...    32   0.63 
AF427497-1|AAL25121.1|  939|Drosophila melanogaster coiled-coil ...    30   3.4  
AF114160-1|AAD26161.2| 2077|Drosophila melanogaster adherin Nipp...    29   7.8  
AE013599-26|EAA46003.3| 2077|Drosophila melanogaster CG17704-PF,...    29   7.8  
AE013599-25|EAA46004.3| 2077|Drosophila melanogaster CG17704-PE,...    29   7.8  

>BT011369-1|AAR96161.1|  261|Drosophila melanogaster RE57333p
           protein.
          Length = 261

 Score =  154 bits (374), Expect = 9e-38
 Identities = 75/134 (55%), Positives = 87/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTDPTYPAG+MDV+++EKT E FRL+YDVKGRF IHRI+ EEAKYKLCKVK+  
Sbjct: 71  KVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K VP+LVTHDGRTIRYPDPLI         +   ++        G           G
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGTVVNRERHPGS 204



 Score =  138 bits (334), Expect = 6e-33
 Identities = 65/75 (86%), Positives = 68/75 (90%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKRL APKAWMLDKLGGV+APRPSTGPHKLRE LPL+IFLRNRLKYAL G E
Sbjct: 1   MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KIV QRL+KV GK
Sbjct: 61  VTKIVMQRLVKVDGK 75



 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P   + DS+Q+DIA+ KI D+IKF+SGNLCMITGGRNLGRVGT+V        FDIVHIK
Sbjct: 152 PLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIK 211

Query: 671 DS 676
           DS
Sbjct: 212 DS 213


>AE014296-2240|AAF49846.1|  261|Drosophila melanogaster CG11276-PB,
           isoform B protein.
          Length = 261

 Score =  154 bits (374), Expect = 9e-38
 Identities = 75/134 (55%), Positives = 87/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTDPTYPAG+MDV+++EKT E FRL+YDVKGRF IHRI+ EEAKYKLCKVK+  
Sbjct: 71  KVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K VP+LVTHDGRTIRYPDPLI         +   ++        G           G
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGTVVNRERHPGS 204



 Score =  138 bits (334), Expect = 6e-33
 Identities = 65/75 (86%), Positives = 68/75 (90%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKRL APKAWMLDKLGGV+APRPSTGPHKLRE LPL+IFLRNRLKYAL G E
Sbjct: 1   MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KIV QRL+KV GK
Sbjct: 61  VTKIVMQRLVKVDGK 75



 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P   + DS+Q+DIA+ KI D+IKF+SGNLCMITGGRNLGRVGT+V        FDIVHIK
Sbjct: 152 PLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIK 211

Query: 671 DS 676
           DS
Sbjct: 212 DS 213


>AE014296-2239|AAF49847.1|  261|Drosophila melanogaster CG11276-PA,
           isoform A protein.
          Length = 261

 Score =  154 bits (374), Expect = 9e-38
 Identities = 75/134 (55%), Positives = 87/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTDPTYPAG+MDV+++EKT E FRL+YDVKGRF IHRI+ EEAKYKLCKVK+  
Sbjct: 71  KVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K VP+LVTHDGRTIRYPDPLI         +   ++        G           G
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGTVVNRERHPGS 204



 Score =  138 bits (334), Expect = 6e-33
 Identities = 65/75 (86%), Positives = 68/75 (90%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKRL APKAWMLDKLGGV+APRPSTGPHKLRE LPL+IFLRNRLKYAL G E
Sbjct: 1   MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KIV QRL+KV GK
Sbjct: 61  VTKIVMQRLVKVDGK 75



 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P   + DS+Q+DIA+ KI D+IKF+SGNLCMITGGRNLGRVGT+V        FDIVHIK
Sbjct: 152 PLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIK 211

Query: 671 DS 676
           DS
Sbjct: 212 DS 213


>D16257-1|BAA03786.1|  261|Drosophila melanogaster ribosomal protein
           S4 protein.
          Length = 261

 Score =  151 bits (366), Expect = 9e-37
 Identities = 73/131 (55%), Positives = 85/131 (64%)
 Frame = +3

Query: 258 GKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGP 437
           GKVRTDPTYPAG+MDV+++EKT E FRL+YDVKGRF IHRI+ EEAKYKLCKVK+   G 
Sbjct: 74  GKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGA 133

Query: 438 KNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVWA 617
           K VP+LVTHDGRTIRYPDPLI         +   ++        G           G   
Sbjct: 134 KGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVG 193

Query: 618 PSCSRERHPGS 650
              +RERHPGS
Sbjct: 194 TVVNRERHPGS 204



 Score =  137 bits (331), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKRL APKAWMLDKLGGV+APRPSTGPHKLRE LPL+ FLRNRLKYAL G E
Sbjct: 1   MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLTFLRNRLKYALNGAE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KIV QRL+KV GK
Sbjct: 61  VTKIVMQRLVKVYGK 75



 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P   + DS+Q+DIA+ KI D+IKF+SGNLCMITGGRNLGRVGT+V        FDIVHIK
Sbjct: 152 PLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIK 211

Query: 671 DS 676
           DS
Sbjct: 212 DS 213


>BT021421-1|AAX33569.1| 1098|Drosophila melanogaster LD02690p
           protein.
          Length = 1098

 Score = 32.3 bits (70), Expect = 0.63
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 75  KRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTPHKG 254
           K  QS+D  +    +     NR+ ++ + L+ G+  E+     FDRK SP   ET P K 
Sbjct: 555 KVHQSLDESKMLALIEGALDNRNVKLEQNLSAGEETEDDD--VFDRKESPSFLETNPFKD 612

Query: 255 DGK 263
           D +
Sbjct: 613 DAQ 615


>AY051840-1|AAK93264.1|  561|Drosophila melanogaster LD34444p
           protein.
          Length = 561

 Score = 32.3 bits (70), Expect = 0.63
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 75  KRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTPHKG 254
           K  QS+D  +    +     NR+ ++ + L+ G+  E+     FDRK SP   ET P K 
Sbjct: 18  KVHQSLDESKMLALIEGALDNRNVKLEQNLSAGEETEDDD--VFDRKESPSFLETNPFKD 75

Query: 255 DGK 263
           D +
Sbjct: 76  DAQ 78


>AE013599-2039|AAF58149.3| 1098|Drosophila melanogaster CG8155-PA
           protein.
          Length = 1098

 Score = 32.3 bits (70), Expect = 0.63
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 75  KRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTPHKG 254
           K  QS+D  +    +     NR+ ++ + L+ G+  E+     FDRK SP   ET P K 
Sbjct: 555 KVHQSLDESKMLALIEGALDNRNVKLEQNLSAGEETEDDD--VFDRKESPSFLETNPFKD 612

Query: 255 DGK 263
           D +
Sbjct: 613 DAQ 615


>AF427497-1|AAL25121.1|  939|Drosophila melanogaster coiled-coil Y
           protein protein.
          Length = 939

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 493 HLSKSRFHPVRHCNYEDYGLHQV*VRELVYDHGR 594
           ++ KSRF+ + H  Y  +GLH +  REL Y H R
Sbjct: 801 NVPKSRFYAICHKLYH-HGLHTLDFRELTYMHKR 833


>AF114160-1|AAD26161.2| 2077|Drosophila melanogaster adherin Nipped-B
            protein.
          Length = 2077

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = -2

Query: 476  GAAIMRY-QVRNILRSGRH-TLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 318
            G  ++RY   + I +S R  +LD+  +V + LR DTV+    +NIID   Q I L
Sbjct: 888  GTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSIKL 942


>AE013599-26|EAA46003.3| 2077|Drosophila melanogaster CG17704-PF,
            isoform F protein.
          Length = 2077

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = -2

Query: 476  GAAIMRY-QVRNILRSGRH-TLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 318
            G  ++RY   + I +S R  +LD+  +V + LR DTV+    +NIID   Q I L
Sbjct: 888  GTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSIKL 942


>AE013599-25|EAA46004.3| 2077|Drosophila melanogaster CG17704-PE,
            isoform E protein.
          Length = 2077

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = -2

Query: 476  GAAIMRY-QVRNILRSGRH-TLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 318
            G  ++RY   + I +S R  +LD+  +V + LR DTV+    +NIID   Q I L
Sbjct: 888  GTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSIKL 942


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,774,456
Number of Sequences: 53049
Number of extensions: 786438
Number of successful extensions: 2456
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 2318
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2450
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2971922400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -