SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X59449-1|CAA42068.1|  883|Drosophila melanogaster dynamin protein.    167   1e-41
X59448-1|CAA42067.1|  836|Drosophila melanogaster dynamin protein.    167   1e-41
X59435-1|CAA42061.1|  836|Drosophila melanogaster dynamnin-like ...   167   1e-41
BT010049-1|AAQ22518.1|  877|Drosophila melanogaster LD21622p pro...   167   1e-41
AE014298-2280|ABI30984.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2279|ABI30983.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2278|AAS65369.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2277|AAN09373.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2276|AAN09372.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2275|AAS65368.1|  830|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2274|AAS65367.1|  877|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2273|AAS65366.1|  877|Drosophila melanogaster CG18102-P...   167   1e-41
AE014298-2272|AAF48536.2|  877|Drosophila melanogaster CG18102-P...   167   1e-41
BT001269-1|AAN71025.1|  735|Drosophila melanogaster AT04516p pro...   108   7e-24
AE014134-434|AAF51235.1|  735|Drosophila melanogaster CG3210-PA ...   108   7e-24
AY058366-1|AAL13595.1|  933|Drosophila melanogaster GH13793p pro...    54   2e-07
AE013599-1850|AAF58275.2|  972|Drosophila melanogaster CG8479-PA...    54   2e-07
AE013599-1849|AAM70993.1|  933|Drosophila melanogaster CG8479-PB...    54   2e-07
AE013599-1993|ABI31091.1|  503|Drosophila melanogaster CG10261-P...    30   3.0  
Y10018-1|CAA71125.1|  436|Drosophila melanogaster ANON-66Db prot...    28   9.2  
Y10015-3|CAA71122.1|  436|Drosophila melanogaster ANON-66Db prot...    28   9.2  
AY089506-1|AAL90244.1|  154|Drosophila melanogaster GH14656p pro...    28   9.2  

>X59449-1|CAA42068.1|  883|Drosophila melanogaster dynamin protein.
          Length = 883

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>X59448-1|CAA42067.1|  836|Drosophila melanogaster dynamin protein.
          Length = 836

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>X59435-1|CAA42061.1|  836|Drosophila melanogaster dynamnin-like
           protein protein.
          Length = 836

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>BT010049-1|AAQ22518.1|  877|Drosophila melanogaster LD21622p
           protein.
          Length = 877

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2280|ABI30984.1|  830|Drosophila melanogaster CG18102-PI,
           isoform I protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2279|ABI30983.1|  830|Drosophila melanogaster CG18102-PH,
           isoform H protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2278|AAS65369.1|  830|Drosophila melanogaster CG18102-PE,
           isoform E protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2277|AAN09373.1|  830|Drosophila melanogaster CG18102-PC,
           isoform C protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2276|AAN09372.1|  830|Drosophila melanogaster CG18102-PB,
           isoform B protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2275|AAS65368.1|  830|Drosophila melanogaster CG18102-PA,
           isoform A protein.
          Length = 830

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2274|AAS65367.1|  877|Drosophila melanogaster CG18102-PG,
           isoform G protein.
          Length = 877

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2273|AAS65366.1|  877|Drosophila melanogaster CG18102-PF,
           isoform F protein.
          Length = 877

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>AE014298-2272|AAF48536.2|  877|Drosophila melanogaster CG18102-PD,
           isoform D protein.
          Length = 877

 Score =  167 bits (406), Expect = 1e-41
 Identities = 80/89 (89%), Positives = 86/89 (96%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQIK MIFQFIR+E+CLILAVTPANTDLANSDALKLAKEVDPQG+RTIGVITKLDLMDEG
Sbjct: 149 QQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG 208

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARD+LENKLLPLRRGYIGVVNR +K +
Sbjct: 209 TDARDILENKLLPLRRGYIGVVNRSQKDI 237



 Score =  143 bits (346), Expect = 2e-34
 Identities = 67/81 (82%), Positives = 73/81 (90%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLING TEY EFLH KGKKF+ F+E+R EIE ETDRVTGSNKGIS +PINLRVYSP+VLN
Sbjct: 67  QLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLN 126

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKV IGDQP+DI
Sbjct: 127 LTLIDLPGLTKVAIGDQPVDI 147



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 32/36 (88%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+GRKDI  ALAAERKFFLSHPSYRH+ADRLGT
Sbjct: 234 QKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGT 269


>BT001269-1|AAN71025.1|  735|Drosophila melanogaster AT04516p
           protein.
          Length = 735

 Score =  108 bits (259), Expect = 7e-24
 Identities = 49/74 (66%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+  FLH K K FTDF+E+R EIE ET+R  GSNKGI P PINL+++S +V+NLTL+DLP
Sbjct: 89  EWGRFLHTK-KCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLP 147

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 148 GITKVPVGDQPEDI 161



 Score =  107 bits (258), Expect = 9e-24
 Identities = 49/88 (55%), Positives = 69/88 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK ++ ++I   + +ILAVT ANTD+A S+ALKLAK+VDP G RT+ V+TKLDLMD GT
Sbjct: 164 QIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGT 223

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DA D+L  +++P++ G IGV+NR +K +
Sbjct: 224 DAIDILCGRVIPVKLGIIGVMNRSQKDI 251


>AE014134-434|AAF51235.1|  735|Drosophila melanogaster CG3210-PA
           protein.
          Length = 735

 Score =  108 bits (259), Expect = 7e-24
 Identities = 49/74 (66%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+  FLH K K FTDF+E+R EIE ET+R  GSNKGI P PINL+++S +V+NLTL+DLP
Sbjct: 89  EWGRFLHTK-KCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLP 147

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 148 GITKVPVGDQPEDI 161



 Score =  107 bits (258), Expect = 9e-24
 Identities = 49/88 (55%), Positives = 69/88 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK ++ ++I   + +ILAVT ANTD+A S+ALKLAK+VDP G RT+ V+TKLDLMD GT
Sbjct: 164 QIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGT 223

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DA D+L  +++P++ G IGV+NR +K +
Sbjct: 224 DAIDILCGRVIPVKLGIIGVMNRSQKDI 251


>AY058366-1|AAL13595.1|  933|Drosophila melanogaster GH13793p
           protein.
          Length = 933

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 5/122 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +  I  M   ++   + +IL +   + D   S+   L  + DP G RTI V+TK+DL +E
Sbjct: 387 KDSIHQMTKHYMSNPNAIILCIQDGSVDAERSNVTDLVMQCDPLGRRTIFVLTKVDLAEE 446

Query: 433 GTD---ARDVLENKLLPLRR-GYIGVV-NRCRKTLTVART*PLHLRLRENSSLATRHTVI 597
             D    R +L  KL P++  GY  VV  R RK  ++           +NS L  R  VI
Sbjct: 447 LADPDRIRKILSGKLFPMKALGYYAVVTGRGRKDDSIDAIRQYEEDFFKNSKLFHRRGVI 506

Query: 598 WP 603
            P
Sbjct: 507 MP 508



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 16/62 (25%), Positives = 27/62 (43%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           K +D  ++R ++E          K +S   I + V  P +  + L+DLPG+      D  
Sbjct: 324 KESDLQDLRRDVEFRMKASVRGGKTVSNEVIAMTVKGPGLQRMVLVDLPGIISTMTVDMA 383

Query: 245 ID 250
            D
Sbjct: 384 SD 385


>AE013599-1850|AAF58275.2|  972|Drosophila melanogaster CG8479-PA,
           isoform A protein.
          Length = 972

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 5/122 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +  I  M   ++   + +IL +   + D   S+   L  + DP G RTI V+TK+DL +E
Sbjct: 426 KDSIHQMTKHYMSNPNAIILCIQDGSVDAERSNVTDLVMQCDPLGRRTIFVLTKVDLAEE 485

Query: 433 GTD---ARDVLENKLLPLRR-GYIGVV-NRCRKTLTVART*PLHLRLRENSSLATRHTVI 597
             D    R +L  KL P++  GY  VV  R RK  ++           +NS L  R  VI
Sbjct: 486 LADPDRIRKILSGKLFPMKALGYYAVVTGRGRKDDSIDAIRQYEEDFFKNSKLFHRRGVI 545

Query: 598 WP 603
            P
Sbjct: 546 MP 547



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 16/62 (25%), Positives = 27/62 (43%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           K +D  ++R ++E          K +S   I + V  P +  + L+DLPG+      D  
Sbjct: 363 KESDLQDLRRDVEFRMKASVRGGKTVSNEVIAMTVKGPGLQRMVLVDLPGIISTMTVDMA 422

Query: 245 ID 250
            D
Sbjct: 423 SD 424


>AE013599-1849|AAM70993.1|  933|Drosophila melanogaster CG8479-PB,
           isoform B protein.
          Length = 933

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 5/122 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +  I  M   ++   + +IL +   + D   S+   L  + DP G RTI V+TK+DL +E
Sbjct: 387 KDSIHQMTKHYMSNPNAIILCIQDGSVDAERSNVTDLVMQCDPLGRRTIFVLTKVDLAEE 446

Query: 433 GTD---ARDVLENKLLPLRR-GYIGVV-NRCRKTLTVART*PLHLRLRENSSLATRHTVI 597
             D    R +L  KL P++  GY  VV  R RK  ++           +NS L  R  VI
Sbjct: 447 LADPDRIRKILSGKLFPMKALGYYAVVTGRGRKDDSIDAIRQYEEDFFKNSKLFHRRGVI 506

Query: 598 WP 603
            P
Sbjct: 507 MP 508



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 16/62 (25%), Positives = 27/62 (43%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           K +D  ++R ++E          K +S   I + V  P +  + L+DLPG+      D  
Sbjct: 324 KESDLQDLRRDVEFRMKASVRGGKTVSNEVIAMTVKGPGLQRMVLVDLPGIISTMTVDMA 383

Query: 245 ID 250
            D
Sbjct: 384 SD 385


>AE013599-1993|ABI31091.1|  503|Drosophila melanogaster CG10261-PF,
           isoform F protein.
          Length = 503

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 5/52 (9%)
 Frame = +1

Query: 163 ACLFPECAQPDAD*FAGSDKSANR*SAYRYRQ--QIKGMIFQ---FIRRESC 303
           ACLFP   Q       G D+S  R  A R+R+  ++ G IFQ   F RR  C
Sbjct: 5   ACLFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFC 56


>Y10018-1|CAA71125.1|  436|Drosophila melanogaster ANON-66Db
           protein.
          Length = 436

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +3

Query: 507 MQKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTL 620
           M++ +   KD+   L A+ K   SHP +   AD LG L
Sbjct: 254 MKRRLCNNKDVFRCLQAKLKATASHPKHSAFADILGQL 291


>Y10015-3|CAA71122.1|  436|Drosophila melanogaster ANON-66Db protein
           protein.
          Length = 436

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +3

Query: 507 MQKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTL 620
           M++ +   KD+   L A+ K   SHP +   AD LG L
Sbjct: 254 MKRRLCNNKDVFRCLQAKLKATASHPKHSAFADILGQL 291


>AY089506-1|AAL90244.1|  154|Drosophila melanogaster GH14656p
           protein.
          Length = 154

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = -3

Query: 399 DSTQSLWVYFFGKLQSIAVGQIRVG 325
           DS+Q++W+Y   + +S+    +R+G
Sbjct: 79  DSSQTVWIYAIARSKSLLTADVRIG 103


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,798,572
Number of Sequences: 53049
Number of extensions: 554940
Number of successful extensions: 1672
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1594
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1672
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2662347150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -