SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001760-1|AAN71515.1|  159|Drosophila melanogaster RH06526p pro...   128   6e-30
AY071556-1|AAL49178.1|  159|Drosophila melanogaster RE62581p pro...   128   6e-30
AE014134-3588|AAF57259.1|  159|Drosophila melanogaster CG12775-P...   128   6e-30
AE014298-789|AAN09151.2|  312|Drosophila melanogaster CG15771-PB...    29   3.9  
AE014298-788|AAF46077.4|  355|Drosophila melanogaster CG15771-PA...    29   3.9  
U28966-1|AAB52512.1|  419|Drosophila melanogaster septin protein.      29   5.2  
AY061281-1|AAL28829.1|  419|Drosophila melanogaster LD20082p pro...    29   5.2  
AE014297-2823|AAF55783.1|  419|Drosophila melanogaster CG4173-PA...    29   5.2  
AE014297-110|AAF52119.1|  975|Drosophila melanogaster CG9783-PA ...    28   9.1  
AE014296-2825|AAS64979.1| 1431|Drosophila melanogaster CG33256-P...    28   9.1  
AE014134-92|AAN10495.1|  713|Drosophila melanogaster CG31921-PA ...    28   9.1  

>BT001760-1|AAN71515.1|  159|Drosophila melanogaster RH06526p
           protein.
          Length = 159

 Score =  128 bits (308), Expect = 6e-30
 Identities = 55/82 (67%), Positives = 69/82 (84%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           +RVRG+I+ KR+N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK 
Sbjct: 78  KRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKK 137

Query: 434 AHIVSGTEKPVLLAPIPYEFVA 499
           AH V   E+P+ LAPIPYEF+A
Sbjct: 138 AHFVKKLEEPIALAPIPYEFIA 159



 Score =  109 bits (261), Expect = 3e-24
 Identities = 45/59 (76%), Positives = 55/59 (93%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG IPLSTYM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVN
Sbjct: 19  FRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVN 77



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +1

Query: 25 MTNSKGYXXGTRDLFAR 75
          MTNSKGY  GTRD+F+R
Sbjct: 1  MTNSKGYRRGTRDMFSR 17


>AY071556-1|AAL49178.1|  159|Drosophila melanogaster RE62581p
           protein.
          Length = 159

 Score =  128 bits (308), Expect = 6e-30
 Identities = 55/82 (67%), Positives = 69/82 (84%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           +RVRG+I+ KR+N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK 
Sbjct: 78  KRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKK 137

Query: 434 AHIVSGTEKPVLLAPIPYEFVA 499
           AH V   E+P+ LAPIPYEF+A
Sbjct: 138 AHFVKKLEEPIALAPIPYEFIA 159



 Score =  109 bits (261), Expect = 3e-24
 Identities = 45/59 (76%), Positives = 55/59 (93%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG IPLSTYM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVN
Sbjct: 19  FRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVN 77



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +1

Query: 25 MTNSKGYXXGTRDLFAR 75
          MTNSKGY  GTRD+F+R
Sbjct: 1  MTNSKGYRRGTRDMFSR 17


>AE014134-3588|AAF57259.1|  159|Drosophila melanogaster CG12775-PA
           protein.
          Length = 159

 Score =  128 bits (308), Expect = 6e-30
 Identities = 55/82 (67%), Positives = 69/82 (84%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           +RVRG+I+ KR+N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK 
Sbjct: 78  KRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKK 137

Query: 434 AHIVSGTEKPVLLAPIPYEFVA 499
           AH V   E+P+ LAPIPYEF+A
Sbjct: 138 AHFVKKLEEPIALAPIPYEFIA 159



 Score =  109 bits (261), Expect = 3e-24
 Identities = 45/59 (76%), Positives = 55/59 (93%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG IPLSTYM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVN
Sbjct: 19  FRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVN 77



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +1

Query: 25 MTNSKGYXXGTRDLFAR 75
          MTNSKGY  GTRD+F+R
Sbjct: 1  MTNSKGYRRGTRDMFSR 17


>AE014298-789|AAN09151.2|  312|Drosophila melanogaster CG15771-PB,
           isoform B protein.
          Length = 312

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = +2

Query: 65  CSLAVPHTWNYSALHVH-ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSC 235
           C     H +++     H E  Q   H  HQRQW   +G    S+P  D S  + + SC
Sbjct: 254 CVPGAGHGYHHHHHQQHQEQQQQHHHHHHQRQWLYRRGV---SLPAMDCSNSEAENSC 308


>AE014298-788|AAF46077.4|  355|Drosophila melanogaster CG15771-PA,
           isoform A protein.
          Length = 355

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = +2

Query: 65  CSLAVPHTWNYSALHVH-ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSC 235
           C     H +++     H E  Q   H  HQRQW   +G    S+P  D S  + + SC
Sbjct: 297 CVPGAGHGYHHHHHQQHQEQQQQHHHHHHQRQWLYRRGV---SLPAMDCSNSEAENSC 351


>U28966-1|AAB52512.1|  419|Drosophila melanogaster septin protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 281 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 430
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AY061281-1|AAL28829.1|  419|Drosophila melanogaster LD20082p
           protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 281 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 430
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AE014297-2823|AAF55783.1|  419|Drosophila melanogaster CG4173-PA
           protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 281 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 430
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AE014297-110|AAF52119.1|  975|Drosophila melanogaster CG9783-PA
           protein.
          Length = 975

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +2

Query: 344 RVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKP 463
           R   N    + +  AG++V +K +  PP  A + SGT  P
Sbjct: 615 RTSTNPSSSQSSSLAGESVEVKVEITPPTNADLASGTNLP 654


>AE014296-2825|AAS64979.1| 1431|Drosophila melanogaster CG33256-PA
           protein.
          Length = 1431

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 420 LPLKLPTSSVELRNPSYLRLSHTNS 494
           LPL LPT S+E+  P     SHT +
Sbjct: 339 LPLPLPTISIEIAEPPEENASHTEA 363


>AE014134-92|AAN10495.1|  713|Drosophila melanogaster CG31921-PA
           protein.
          Length = 713

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +2

Query: 227 CSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVK 352
           C+C+ CDC    +  I PK  +I  E     K  +++L+R++
Sbjct: 592 CACTICDCLYGTKIPISPKMQSIMAEEKLREK--REYLRRMR 631


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,971,715
Number of Sequences: 53049
Number of extensions: 499483
Number of successful extensions: 1764
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1709
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1764
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1991467008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -