SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-1185|AAF52451.1|  253|Drosophila melanogaster CG13773-P...    56   3e-08
AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P...    29   5.0  
AY118479-1|AAM49848.1|  240|Drosophila melanogaster GM16372p pro...    28   8.7  
AE014296-1998|AAF50032.1|  240|Drosophila melanogaster CG7339-PA...    28   8.7  

>AE014134-1185|AAF52451.1|  253|Drosophila melanogaster CG13773-PA
           protein.
          Length = 253

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 24/70 (34%), Positives = 43/70 (61%)
 Frame = +3

Query: 261 LNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 440
           L+G+++  KN  +L     +R D+  +H  + AD+++F+P  GA L+G+V      H+S 
Sbjct: 66  LDGIVLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSA 125

Query: 441 LVHRVFNVVI 470
           +++RVFN  I
Sbjct: 126 VIYRVFNTSI 135



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +1

Query: 79  IMSKIIKFDLRELKQLANDKNSCLVVKKITQNLALQPWCLGNIKESITNLL-DYKVGKFE 255
           I+ K IKF ++EL+  A+   SC+       +LA+ P+ + N K ++  LL   KVG ++
Sbjct: 4   ILQKYIKFSVKELENYASSPESCVRCITTDMHLAMGPYGMANFKHALHELLIRTKVGFYD 63



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +2

Query: 473 TANRRAWRQVDRSSVKEGQEVTFRIAALDLYGALPYIRGEL 595
           T+ R   +   R  +   QE+  RI   D+   +PYI GEL
Sbjct: 133 TSIRFTNQSASREDIAMDQEIKIRIKNFDISNLMPYIEGEL 173


>AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB
             protein.
          Length = 23015

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 282   YKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSVL 443
             Y+NPC    V   R + A    Q   +Y+   PY G +   ++N  CS+HL+ L
Sbjct: 17964 YQNPCGSNAVCRERGEAASC--QCLPEYY-GNPYEGCRPECVLNSDCSSHLACL 18014


>AY118479-1|AAM49848.1|  240|Drosophila melanogaster GM16372p
           protein.
          Length = 240

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +3

Query: 267 GVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCS 425
           G+ ++ K+   L++   +  D A  H +V   Y +F+P +G  +TG + + CS
Sbjct: 43  GLCIALKDIVSLKDSIILPGDGAS-HTEVLFRYVVFRPMVGTVITGKI-RNCS 93


>AE014296-1998|AAF50032.1|  240|Drosophila melanogaster CG7339-PA
           protein.
          Length = 240

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +3

Query: 267 GVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCS 425
           G+ ++ K+   L++   +  D A  H +V   Y +F+P +G  +TG + + CS
Sbjct: 43  GLCIALKDIVSLKDSIILPGDGAS-HTEVLFRYVVFRPMVGTVITGKI-RNCS 93


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,322,061
Number of Sequences: 53049
Number of extensions: 463292
Number of successful extensions: 817
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 773
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 817
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2517878700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -