SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069088-1|AAL39233.1|  669|Drosophila melanogaster GH10354p pro...    32   0.48 
AE013599-2915|AAF57543.2|  669|Drosophila melanogaster CG11228-P...    32   0.48 
AY075401-1|AAL68231.1| 1326|Drosophila melanogaster LD30271p pro...    31   0.84 
AY061300-1|AAL28848.1| 1326|Drosophila melanogaster LD21322p pro...    31   0.84 
AE014296-806|AAG22246.1| 1326|Drosophila melanogaster CG15010-PC...    31   0.84 
AE014296-805|AAG22247.1| 1326|Drosophila melanogaster CG15010-PB...    31   0.84 
AE014296-804|AAF47869.1| 1326|Drosophila melanogaster CG15010-PA...    31   0.84 
AY113388-1|AAM29393.1|  990|Drosophila melanogaster RE06257p pro...    31   1.1  
AL021106-1|CAA15936.1|  990|Drosophila melanogaster EG:63B12.6 p...    31   1.1  
AE014298-268|AAF45674.1| 1052|Drosophila melanogaster CG14814-PB...    31   1.1  
AE014298-267|AAN09061.2| 1030|Drosophila melanogaster CG14814-PA...    31   1.1  
AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA...    30   1.9  
U09506-1|AAA56998.1| 2186|Drosophila melanogaster tiggrin protein.     30   2.6  
AY113649-1|AAM29654.1|  701|Drosophila melanogaster SD12335p pro...    30   2.6  
AL133503-6|CAB72241.1| 1009|Drosophila melanogaster EG:BACH48C10...    30   2.6  
AE014298-394|AAS65251.1| 1535|Drosophila melanogaster CG14047-PB...    30   2.6  
AE014298-393|AAF45777.2| 1395|Drosophila melanogaster CG14047-PA...    30   2.6  
AE014296-828|AAN11599.1| 1465|Drosophila melanogaster CG32251-PA...    30   2.6  
AE014134-1089|AAF52380.2| 2188|Drosophila melanogaster CG11527-P...    30   2.6  
AF217281-1|AAF27637.1| 1616|Drosophila melanogaster ecdysone-ind...    29   4.5  
AY089509-1|AAL90247.1| 1089|Drosophila melanogaster GH19076p pro...    29   5.9  
AY069428-1|AAL39573.1|  844|Drosophila melanogaster LD13864p pro...    29   5.9  
AY051979-1|AAK93403.1| 1693|Drosophila melanogaster LD44801p pro...    29   5.9  
AE014297-4129|AAF56714.1|  154|Drosophila melanogaster CG5402-PA...    29   5.9  
AE014297-573|AAF54052.2| 1693|Drosophila melanogaster CG2507-PB,...    29   5.9  
AE013599-601|AAF59125.2| 1089|Drosophila melanogaster CG8709-PA ...    29   5.9  
AE013599-91|AAF57324.2|  844|Drosophila melanogaster CG8426-PA p...    29   5.9  
BT025903-1|ABG02147.1|  464|Drosophila melanogaster IP03868p pro...    28   7.8  
BT009964-1|AAQ22433.1|  405|Drosophila melanogaster RE70525p pro...    28   7.8  
AY058540-1|AAL13769.1|  861|Drosophila melanogaster LD24267p pro...    28   7.8  
AL121806-14|CAB58099.1|  861|Drosophila melanogaster EG:33C11.2 ...    28   7.8  
AF044203-1|AAC02081.1|  569|Drosophila melanogaster calcium bind...    28   7.8  
AF034856-1|AAB87987.1|  534|Drosophila melanogaster EF-hand prot...    28   7.8  
AF011354-1|AAB65794.1|  543|Drosophila melanogaster calcium bind...    28   7.8  
AE014298-169|AAF45598.1|  861|Drosophila melanogaster CG11403-PA...    28   7.8  
AE014297-52|AAX52940.1|  699|Drosophila melanogaster CG9795-PD, ...    28   7.8  
AE014296-2962|AAF49304.3|  569|Drosophila melanogaster CG32190-P...    28   7.8  
AE014134-2090|AAF53116.1|  814|Drosophila melanogaster CG12602-P...    28   7.8  
AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-P...    28   7.8  
AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein.    28   7.8  

>AY069088-1|AAL39233.1|  669|Drosophila melanogaster GH10354p
           protein.
          Length = 669

 Score = 32.3 bits (70), Expect = 0.48
 Identities = 13/55 (23%), Positives = 29/55 (52%)
 Frame = +3

Query: 303 KRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVS 467
           ++P+    +P   + Q+ + Q  +  +  E+ ++S  ND+N  E  +   FQ++S
Sbjct: 476 EKPIATEYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEHNMEMQFQQIS 530


>AE013599-2915|AAF57543.2|  669|Drosophila melanogaster CG11228-PA
           protein.
          Length = 669

 Score = 32.3 bits (70), Expect = 0.48
 Identities = 13/55 (23%), Positives = 29/55 (52%)
 Frame = +3

Query: 303 KRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVS 467
           ++P+    +P   + Q+ + Q  +  +  E+ ++S  ND+N  E  +   FQ++S
Sbjct: 476 EKPIATEYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEHNMEMQFQQIS 530


>AY075401-1|AAL68231.1| 1326|Drosophila melanogaster LD30271p
           protein.
          Length = 1326

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D   P P +  E E    E  EDA  IV+   +  NT+++AL  G    +DG  K +  T
Sbjct: 169 DDEEPEPEEDDEEELIEDED-EDAVDIVTGAISCPNTSQLALADGTIMAADG-SKIFLET 226

Query: 498 EQIKSSRP 521
             ++ ++P
Sbjct: 227 PVVEEAQP 234


>AY061300-1|AAL28848.1| 1326|Drosophila melanogaster LD21322p
           protein.
          Length = 1326

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D   P P +  E E    E  EDA  IV+   +  NT+++AL  G    +DG  K +  T
Sbjct: 169 DDEEPEPEEDDEEELIEDED-EDAVDIVTGAISCPNTSQLALADGTIMAADG-SKIFLET 226

Query: 498 EQIKSSRP 521
             ++ ++P
Sbjct: 227 PVVEEAQP 234


>AE014296-806|AAG22246.1| 1326|Drosophila melanogaster CG15010-PC,
           isoform C protein.
          Length = 1326

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D   P P +  E E    E  EDA  IV+   +  NT+++AL  G    +DG  K +  T
Sbjct: 169 DDEEPEPEEDDEEELIEDED-EDAVDIVTGAISCPNTSQLALADGTIMAADG-SKIFLET 226

Query: 498 EQIKSSRP 521
             ++ ++P
Sbjct: 227 PVVEEAQP 234


>AE014296-805|AAG22247.1| 1326|Drosophila melanogaster CG15010-PB,
           isoform B protein.
          Length = 1326

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D   P P +  E E    E  EDA  IV+   +  NT+++AL  G    +DG  K +  T
Sbjct: 169 DDEEPEPEEDDEEELIEDED-EDAVDIVTGAISCPNTSQLALADGTIMAADG-SKIFLET 226

Query: 498 EQIKSSRP 521
             ++ ++P
Sbjct: 227 PVVEEAQP 234


>AE014296-804|AAF47869.1| 1326|Drosophila melanogaster CG15010-PA,
           isoform A protein.
          Length = 1326

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D   P P +  E E    E  EDA  IV+   +  NT+++AL  G    +DG  K +  T
Sbjct: 169 DDEEPEPEEDDEEELIEDED-EDAVDIVTGAISCPNTSQLALADGTIMAADG-SKIFLET 226

Query: 498 EQIKSSRP 521
             ++ ++P
Sbjct: 227 PVVEEAQP 234


>AY113388-1|AAM29393.1|  990|Drosophila melanogaster RE06257p
           protein.
          Length = 990

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 419
           + E  DE+    R    L +    QHQEH+ Q+P+ H+ +   V     D
Sbjct: 340 SAEDDDEHYSSPRATKSLPSSEEVQHQEHQQQDPQSHQKSMLSVDDASED 389


>AL021106-1|CAA15936.1|  990|Drosophila melanogaster EG:63B12.6
           protein.
          Length = 990

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 419
           + E  DE+    R    L +    QHQEH+ Q+P+ H+ +   V     D
Sbjct: 340 SAEDDDEHYSSPRATKSLPSSEEVQHQEHQQQDPQSHQKSMLSVDDASED 389


>AE014298-268|AAF45674.1| 1052|Drosophila melanogaster CG14814-PB,
           isoform B protein.
          Length = 1052

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 419
           + E  DE+    R    L +    QHQEH+ Q+P+ H+ +   V     D
Sbjct: 402 SAEDDDEHYSSPRATKSLPSSEEVQHQEHQQQDPQSHQKSMLSVDDASED 451


>AE014298-267|AAN09061.2| 1030|Drosophila melanogaster CG14814-PA,
           isoform A protein.
          Length = 1030

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 419
           + E  DE+    R    L +    QHQEH+ Q+P+ H+ +   V     D
Sbjct: 380 SAEDDDEHYSSPRATKSLPSSEEVQHQEHQQQDPQSHQKSMLSVDDASED 429


>AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA
           protein.
          Length = 1801

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINT-AEIAL 443
           EN++ PD+N   K+P V  +     +H +  + + E     +K+ SS+++ +N   E+  
Sbjct: 156 ENLDEPDQNTIFKKPEVSSK-INLEKHNQRTSTDKEKQYKGQKLNSSIESILNVYDELPS 214

Query: 444 RQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
               Q ++    +  A T ++  S P  NI KK
Sbjct: 215 HSDNQALNLSQKRNNAWTTKLPESSPK-NIPKK 246


>U09506-1|AAA56998.1| 2186|Drosophila melanogaster tiggrin protein.
          Length = 2186

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 13/59 (22%), Positives = 32/59 (54%)
 Frame = +3

Query: 258  SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            ++  +V + + +  +K+ + DLR  G  + ++ +T      +  + ++S  KN ++TAE
Sbjct: 1184 AEQHHVHIEEVDNYVKQVIEDLRKNGQFEIEQLQTWQRVERDYIKSLISEYKNSLSTAE 1242


>AY113649-1|AAM29654.1|  701|Drosophila melanogaster SD12335p
           protein.
          Length = 701

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 15/55 (27%), Positives = 28/55 (50%)
 Frame = +1

Query: 76  DKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEE 240
           D+  E EDKP      ++ ++E+ID+ ++  + D     NK +  + P    VE+
Sbjct: 106 DEEYEPEDKPGYAEVTINEDEEIIDKVDSTAEDDGDAEENKNDADEDPEDNPVED 160


>AL133503-6|CAB72241.1| 1009|Drosophila melanogaster EG:BACH48C10.4
           protein.
          Length = 1009

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 431
           S LE +   D  +E      DL +  P  H  +  QN E  EDA+   + V+ND+  +
Sbjct: 190 SSLEKLPSDDRMDEADELDDDLDSFKPNGHDGNSPQNEEDDEDADSERALVQNDLGAS 247


>AE014298-394|AAS65251.1| 1535|Drosophila melanogaster CG14047-PB,
           isoform B protein.
          Length = 1535

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 431
           S LE +   D  +E      DL +  P  H  +  QN E  EDA+   + V+ND+  +
Sbjct: 645 SSLEKLPSDDRMDEADELDDDLDSFKPNGHDGNSPQNEEDDEDADSERALVQNDLGAS 702


>AE014298-393|AAF45777.2| 1395|Drosophila melanogaster CG14047-PA,
           isoform A protein.
          Length = 1395

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +3

Query: 258 SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 431
           S LE +   D  +E      DL +  P  H  +  QN E  EDA+   + V+ND+  +
Sbjct: 505 SSLEKLPSDDRMDEADELDDDLDSFKPNGHDGNSPQNEEDDEDADSERALVQNDLGAS 562


>AE014296-828|AAN11599.1| 1465|Drosophila melanogaster CG32251-PA
            protein.
          Length = 1465

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 15/55 (27%), Positives = 28/55 (50%)
 Frame = +1

Query: 76   DKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEE 240
            D+  E EDKP      ++ ++E+ID+ ++  + D     NK +  + P    VE+
Sbjct: 870  DEEYEPEDKPGYAEVTINEDEEIIDKVDSTAEDDGDAEENKNDADEDPEDNPVED 924


>AE014134-1089|AAF52380.2| 2188|Drosophila melanogaster CG11527-PA
            protein.
          Length = 2188

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 13/59 (22%), Positives = 32/59 (54%)
 Frame = +3

Query: 258  SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
            ++  +V + + +  +K+ + DLR  G  + ++ +T      +  + ++S  KN ++TAE
Sbjct: 1184 AEQHHVHIEEVDNYVKQVIEDLRKNGQFEIEQLQTWQRVERDYIKSLISEYKNSLSTAE 1242


>AF217281-1|AAF27637.1| 1616|Drosophila melanogaster
            ecdysone-inducible gene E1 protein.
          Length = 1616

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)
 Frame = +3

Query: 255  KSDLENVEVPDE-NEEIKRPLVDLRNPGPPQHQ----EHETQNPEHHEDAEKIVSSVKND 419
            +SD    E P    EE+  P    + P   +HQ    EH+    EH +D ++ +  V+ +
Sbjct: 1139 ESDESKTEQPSALEEELHIPSEAEQTPVEDEHQYDEEEHQQDQEEHQQDEDEPLKEVETE 1198

Query: 420  INTAEIALRQGFQE 461
             +  E A  + FQE
Sbjct: 1199 -SLPEEATTEKFQE 1211


>AY089509-1|AAL90247.1| 1089|Drosophila melanogaster GH19076p
           protein.
          Length = 1089

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = +3

Query: 351 EHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRPACN 530
           E E   P   ED EK    +K D+N   +   +  +EVS    K   +  Q+K +    N
Sbjct: 233 ETEKAIPAVIEDTEKEKDQIKPDVNLTTVTTSEATKEVSKSKTKKRRKKSQMKKNAQRKN 292

Query: 531 IS 536
            S
Sbjct: 293 SS 294


>AY069428-1|AAL39573.1|  844|Drosophila melanogaster LD13864p
           protein.
          Length = 844

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 20/64 (31%), Positives = 26/64 (40%)
 Frame = +1

Query: 25  PCC*LYSCSPHAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKE 204
           P   L + SPH Q  +P       D   NVVD +S +    D  N      NSL   +  
Sbjct: 537 PLSNLQTNSPHIQNGLPVS-DSTNDNSCNVVDTISLKTMAQDAINRSAIDPNSLNQQQTS 595

Query: 205 VIDI 216
            ID+
Sbjct: 596 SIDL 599


>AY051979-1|AAK93403.1| 1693|Drosophila melanogaster LD44801p protein.
          Length = 1693

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +3

Query: 330  PGPPQHQEHETQNPEHHEDAEKI 398
            P PP HQ+H++  P+ H   ++I
Sbjct: 1154 PPPPPHQQHQSLTPQLHPQQQQI 1176


>AE014297-4129|AAF56714.1|  154|Drosophila melanogaster CG5402-PA
           protein.
          Length = 154

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = +1

Query: 373 NTTKMLKKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLRAP 516
           NT  +  +S LPS+ T T R + F     + ++VLE  T   S    P
Sbjct: 106 NTAPVTTESSLPSQETTTTRTTPFTTTESRTESVLETTTTDSSTSTLP 153


>AE014297-573|AAF54052.2| 1693|Drosophila melanogaster CG2507-PB,
            isoform B protein.
          Length = 1693

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +3

Query: 330  PGPPQHQEHETQNPEHHEDAEKI 398
            P PP HQ+H++  P+ H   ++I
Sbjct: 1154 PPPPPHQQHQSLTPQLHPQQQQI 1176


>AE013599-601|AAF59125.2| 1089|Drosophila melanogaster CG8709-PA
           protein.
          Length = 1089

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = +3

Query: 351 EHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRPACN 530
           E E   P   ED EK    +K D+N   +   +  +EVS    K   +  Q+K +    N
Sbjct: 233 ETEKAIPAVIEDTEKEKDQIKPDVNLTTVTTSEATKEVSKSKTKKRRKKSQMKKNAQRKN 292

Query: 531 IS 536
            S
Sbjct: 293 SS 294


>AE013599-91|AAF57324.2|  844|Drosophila melanogaster CG8426-PA
           protein.
          Length = 844

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 20/64 (31%), Positives = 26/64 (40%)
 Frame = +1

Query: 25  PCC*LYSCSPHAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKE 204
           P   L + SPH Q  +P       D   NVVD +S +    D  N      NSL   +  
Sbjct: 537 PLSNLQTNSPHIQNGLPVS-DSTNDNSCNVVDTISLKTMAQDAINRSAIDPNSLNQQQTS 595

Query: 205 VIDI 216
            ID+
Sbjct: 596 SIDL 599


>BT025903-1|ABG02147.1|  464|Drosophila melanogaster IP03868p
           protein.
          Length = 464

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +3

Query: 315 VDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
           +D ++    QH +H+ ++    ED  K++    +D+  A+   R  F+E
Sbjct: 125 IDRKHLKVSQHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKE 173


>BT009964-1|AAQ22433.1|  405|Drosophila melanogaster RE70525p
           protein.
          Length = 405

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = -2

Query: 428 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 333
           C   +FDG+     +FVV  I+C   ++L  P
Sbjct: 219 CKEFMFDGQKSIQQVFVVVAIICIPWMLLGKP 250


>AY058540-1|AAL13769.1|  861|Drosophila melanogaster LD24267p
           protein.
          Length = 861

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
 Frame = +1

Query: 112 VVDNLSSEQELIDQANTIK----DIDNSLRANKKEVIDIPVKVIVEEIKPS 252
           ++  L+SEQ+L ++  ++K    DI+   +A + +    P K  VEE+ PS
Sbjct: 485 ILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPS 535


>AL121806-14|CAB58099.1|  861|Drosophila melanogaster EG:33C11.2
           protein.
          Length = 861

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
 Frame = +1

Query: 112 VVDNLSSEQELIDQANTIK----DIDNSLRANKKEVIDIPVKVIVEEIKPS 252
           ++  L+SEQ+L ++  ++K    DI+   +A + +    P K  VEE+ PS
Sbjct: 485 ILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPS 535


>AF044203-1|AAC02081.1|  569|Drosophila melanogaster calcium binding
           EF-hand proteinprecursor protein.
          Length = 569

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +3

Query: 315 VDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
           +D ++    QH +H+ ++    ED  K++    +D+  A+   R  F+E
Sbjct: 125 IDRKHLKVSQHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKE 173


>AF034856-1|AAB87987.1|  534|Drosophila melanogaster EF-hand protein
           NUCB1 protein.
          Length = 534

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +3

Query: 315 VDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
           +D ++    QH +H+ ++    ED  K++    +D+  A+   R  F+E
Sbjct: 125 IDRKHLKVSQHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKE 173


>AF011354-1|AAB65794.1|  543|Drosophila melanogaster calcium binding
           EF-hand protein protein.
          Length = 543

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +3

Query: 315 VDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
           +D ++    QH +H+ ++    ED  K++    +D+  A+   R  F+E
Sbjct: 125 IDRKHLKVSQHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKE 173


>AE014298-169|AAF45598.1|  861|Drosophila melanogaster CG11403-PA
           protein.
          Length = 861

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
 Frame = +1

Query: 112 VVDNLSSEQELIDQANTIK----DIDNSLRANKKEVIDIPVKVIVEEIKPS 252
           ++  L+SEQ+L ++  ++K    DI+   +A + +    P K  VEE+ PS
Sbjct: 485 ILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPS 535


>AE014297-52|AAX52940.1|  699|Drosophila melanogaster CG9795-PD,
           isoform D protein.
          Length = 699

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 19/77 (24%), Positives = 33/77 (42%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           D  NPG P       ++  H +      +SV+ + N   IAL +  +++SD +     R 
Sbjct: 614 DQINPGIPPPLLPRKKDHAHLKRERSEAASVRKETNQRIIALEKLVEDLSDQVRGKTKRN 673

Query: 498 EQIKSSRPACNISKKIS 548
             + S+     +S K S
Sbjct: 674 PTVSSTAADITLSSKFS 690


>AE014296-2962|AAF49304.3|  569|Drosophila melanogaster CG32190-PA
           protein.
          Length = 569

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +3

Query: 315 VDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
           +D ++    QH +H+ ++    ED  K++    +D+  A+   R  F+E
Sbjct: 125 IDRKHLKVSQHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKE 173


>AE014134-2090|AAF53116.1|  814|Drosophila melanogaster CG12602-PA
           protein.
          Length = 814

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = -2

Query: 428 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 333
           C   +FDG+     +FVV  I+C   ++L  P
Sbjct: 628 CKEFMFDGQKSIQQVFVVVAIICIPWMLLGKP 659


>AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-PA,
           isoform A protein.
          Length = 2376

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE-DAEKIVSSVKNDINTAEIAL 443
           EN +V DE +  K    D      PQ ++H+++ PE +    EK +  V+N  +   +A 
Sbjct: 240 ENQQVYDEVDYSKDETTD----NNPQQEQHDSKEPEQYVLQLEKAMEFVEN-AHQQHVAA 294

Query: 444 RQGFQEVSD 470
            Q +Q+  D
Sbjct: 295 VQSYQKQRD 303


>AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein.
          Length = 2376

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE-DAEKIVSSVKNDINTAEIAL 443
           EN +V DE +  K    D      PQ ++H+++ PE +    EK +  V+N  +   +A 
Sbjct: 240 ENQQVYDEVDYSKDETTD----NNPQQEQHDSKEPEQYVLQLEKAMEFVEN-AHQQHVAA 294

Query: 444 RQGFQEVSD 470
            Q +Q+  D
Sbjct: 295 VQSYQKQRD 303


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,542,226
Number of Sequences: 53049
Number of extensions: 408979
Number of successful extensions: 2952
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 2721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2940
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2255362491
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -