SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M36114-1|AAA28627.1|  651|Drosophila melanogaster protein ( D.me...   133   2e-31
L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock pro...   133   2e-31
BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p pro...   133   2e-31
AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p pro...   133   2e-31
AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF...   133   2e-31
AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE...   133   2e-31
AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD...   133   2e-31
AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC...   133   2e-31
AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB...   133   2e-31
AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA...   133   2e-31
BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p pro...   127   1e-29
L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock pro...   125   6e-29
J01085-1|AAA28629.1|   68|Drosophila melanogaster protein ( Dros...   125   6e-29
BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p pro...   125   6e-29
AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA...   125   6e-29
AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p pro...   121   1e-27
AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock p...   121   1e-27
AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA...   121   1e-27
BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p pro...   120   2e-27
BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p pro...   120   2e-27
BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p pro...   120   2e-27
BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p pro...   120   2e-27
AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb prot...   120   2e-27
AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock p...   120   2e-27
AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA...   120   2e-27
AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-P...   120   2e-27
AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA...   120   2e-27
AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-P...   120   2e-27
AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-P...   120   2e-27
AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-P...   120   2e-27
J01103-1|AAA28640.1|  643|Drosophila melanogaster protein ( D.me...   118   6e-27
AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock p...   118   6e-27
AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock p...   118   6e-27
AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock p...   118   6e-27
AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock p...   118   1e-26
AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock p...   117   1e-26
AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock p...   117   1e-26
AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock p...   117   1e-26
AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock p...   117   1e-26
BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p pro...   113   2e-25
AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD...   113   2e-25
AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC...   113   2e-25
K01297-1|AAA28630.1|   68|Drosophila melanogaster protein ( D.me...   113   3e-25
BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p pro...   113   3e-25
AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA...   113   3e-25
AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock p...   112   6e-25
J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1...   109   3e-24
L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock pro...   102   5e-22
BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p pro...   102   5e-22
AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD...   102   5e-22
AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC...   102   5e-22
AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB...   102   5e-22
AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA...   102   5e-22
L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock pro...    91   1e-18
AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p pro...    91   1e-18
AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA...    91   1e-18
J02569-1|AAA28631.1|  104|Drosophila melanogaster protein ( D.me...    70   3e-12
AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock pr...    65   1e-10
V00213-1|CAA23495.1|  149|Drosophila melanogaster protein ( Dros...    64   2e-10
AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p pro...    64   3e-10
AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC...    64   3e-10
AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB...    64   3e-10
AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA...    64   3e-10
AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p pro...    42   0.001
AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1 pr...    42   0.001
AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA ...    42   0.001
AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p pro...    39   0.008
AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA...    39   0.008
AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.     36   0.045
BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p pro...    31   1.7  
AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-P...    29   8.9  

>M36114-1|AAA28627.1|  651|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 4 (hsc4) gene, exon 2.
           ).
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  109 bits (262), Expect = 4e-24
 Identities = 58/81 (71%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+G NV RIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGPNVPRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p
           protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p
           protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (277), Expect = 6e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVQSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF,
           isoform F protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE,
           isoform E protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD,
           isoform D protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC,
           isoform C protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB,
           isoform B protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA,
           isoform A protein.
          Length = 651

 Score =  133 bits (322), Expect = 2e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  115 bits (276), Expect = 8e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILSIDDGIFEVKSTAGDTHL 228



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/56 (83%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VVS  GKPKI+V YK E KTFFPEE+SSMVLTKMKETAEAYLGKTV NAVITVP
Sbjct: 92  FEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE+   +   +     + + K F P +
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118


>BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p
           protein.
          Length = 680

 Score =  127 bits (307), Expect = 1e-29
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           KM K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQV
Sbjct: 39  KMPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQV 98

Query: 249 AMTP 260
           AM P
Sbjct: 99  AMNP 102



 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 187 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 246

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 247 SVLTIEDGIFEVKATAGDTHL 267



 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 39/56 (69%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+T+P
Sbjct: 131 FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTIP 186



 Score = 74.1 bits (174), Expect = 2e-13
 Identities = 33/57 (57%), Positives = 41/57 (71%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE+       R R   + + K F P +
Sbjct: 101 NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEE 157


>L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 641

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SVLTIEDGIFEVKATAGDTHL 228



 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+TVP
Sbjct: 92  FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVP 147



 Score = 74.1 bits (174), Expect = 2e-13
 Identities = 33/57 (57%), Positives = 41/57 (71%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE+       R R   + + K F P +
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEE 118


>J01085-1|AAA28629.1|   68|Drosophila melanogaster protein (
           Drosophila melanogasterheat shock cognate (hsc70) gene
           (locus 70C), exon 1. ).
          Length = 68

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63


>BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p
           protein.
          Length = 73

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63


>AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA,
           isoform A protein.
          Length = 641

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SVLTIEDGIFEVKATAGDTHL 228



 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+TVP
Sbjct: 92  FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVP 147



 Score = 74.1 bits (174), Expect = 2e-13
 Identities = 33/57 (57%), Positives = 41/57 (71%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE+       R R   + + K F P +
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEE 118


>AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p
           protein.
          Length = 635

 Score =  121 bits (291), Expect = 1e-27
 Identities = 55/59 (93%), Positives = 58/59 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 57/82 (69%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 89.8 bits (213), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++D GKPKI V +KG +K F PEE+SSMVLTKMKETAEAYLG TV++AVITVP
Sbjct: 89  FKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 27/59 (45%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK--TKPFSPRK 424
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+  V+  N + +  +  K   K FSP +
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFK--VINDNGKPKISVEFKGANKCFSPEE 115


>AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock
           protein 68 protein.
          Length = 635

 Score =  121 bits (291), Expect = 1e-27
 Identities = 55/59 (93%), Positives = 58/59 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 57/82 (69%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 89.8 bits (213), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++D GKPKI V +KG +K F PEE+SSMVLTKMKETAEAYLG TV++AVITVP
Sbjct: 89  FKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 27/59 (45%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK--TKPFSPRK 424
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+  V+  N + +  +  K   K FSP +
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFK--VINDNGKPKISVEFKGANKCFSPEE 115


>AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA
           protein.
          Length = 635

 Score =  121 bits (291), Expect = 1e-27
 Identities = 55/59 (93%), Positives = 58/59 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 57/82 (69%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 89.8 bits (213), Expect = 3e-18
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++D GKPKI V +KG +K F PEE+SSMVLTKMKETAEAYLG TV++AVITVP
Sbjct: 89  FKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 27/59 (45%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK--TKPFSPRK 424
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+  V+  N + +  +  K   K FSP +
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFK--VINDNGKPKISVEFKGANKCFSPEE 115


>BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p
           protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRL GRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLTGRKYDDPKIAEDMKHWPFKV 91


>AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FD KRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDPKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 93.5 bits (222), Expect = 3e-19
 Identities = 44/56 (78%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+ + +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGEGITDAVITVP 144



 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 20/33 (60%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRRYDDPKIAEDMKHWPFKV 91


>AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 93.1 bits (221), Expect = 4e-19
 Identities = 43/56 (76%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETA+AYLG+++  AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETADAYLGESITGAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAK LIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKGLIGRKYDDPKIAEDMKHWPFKV 91


>AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 43/56 (76%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV DGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVIDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 24/57 (42%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++ +     +     + ++K F+P +
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVIDGGKPKIGVEYKGESKRFAPEE 115


>AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIYEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  106 bits (254), Expect = 4e-23
 Identities = 57/82 (69%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLI DLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLILDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  109 bits (261), Expect = 5e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  106 bits (254), Expect = 4e-23
 Identities = 57/82 (69%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLI DLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLILDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  105 bits (253), Expect = 5e-23
 Identities = 57/82 (69%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   G RNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGGRNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  105 bits (253), Expect = 5e-23
 Identities = 57/82 (69%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVL FDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLNFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-PA
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  105 bits (253), Expect = 5e-23
 Identities = 57/82 (69%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK    ERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKDERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-PA
           protein.
          Length = 641

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-PA
           protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-PA
           protein.
          Length = 642

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>J01103-1|AAA28640.1|  643|Drosophila melanogaster protein (
           D.melanogaster heatshock protein 70 genes, locus 87A7,
           seg. 2. (partial proximalgene, spacer region and
           complete distal gene). ).
          Length = 643

 Score =  118 bits (285), Expect = 6e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIG+ AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGEPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 146 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 205

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 206 SILTIDEGSLFEVRSTAGDTHL 227



 Score = 90.2 bits (214), Expect = 3e-18
 Identities = 44/57 (77%), Positives = 50/57 (87%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKET-AEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKET AEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAAEAYLGESITDAVITVP 145



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  118 bits (285), Expect = 6e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  118 bits (285), Expect = 6e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  118 bits (285), Expect = 6e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 93.1 bits (221), Expect = 4e-19
 Identities = 43/56 (76%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETA+AYLG+++  AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETADAYLGESITGAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  118 bits (283), Expect = 1e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ RLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSARLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  117 bits (282), Expect = 1e-26
 Identities = 53/58 (91%), Positives = 56/58 (96%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  117 bits (282), Expect = 1e-26
 Identities = 53/58 (91%), Positives = 56/58 (96%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  117 bits (282), Expect = 1e-26
 Identities = 53/58 (91%), Positives = 56/58 (96%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score =  107 bits (256), Expect = 2e-23
 Identities = 57/82 (69%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIF+LGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFELGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  117 bits (282), Expect = 1e-26
 Identities = 53/57 (92%), Positives = 56/57 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAM 58



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 20/30 (66%), Positives = 26/30 (86%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p
           protein.
          Length = 555

 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 121

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 122 SVLTIEDGIFEVKATAGDTHL 142



 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+TVP
Sbjct: 6   FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVP 61


>AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD,
           isoform D protein.
          Length = 555

 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 121

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 122 SVLTIEDGIFEVKATAGDTHL 142



 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+TVP
Sbjct: 6   FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVP 61


>AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC,
           isoform C protein.
          Length = 555

 Score =  113 bits (273), Expect = 2e-25
 Identities = 59/81 (72%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGT   
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDV 121

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 122 SVLTIEDGIFEVKATAGDTHL 142



 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+TVP
Sbjct: 6   FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVP 61


>K01297-1|AAA28630.1|   68|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 87D:
           exon 2. (partial). ).
          Length = 68

 Score =  113 bits (271), Expect = 3e-25
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 M 254
           M
Sbjct: 61  M 61


>BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p
           protein.
          Length = 633

 Score =  113 bits (271), Expect = 3e-25
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 M 254
           M
Sbjct: 61  M 61



 Score =  110 bits (264), Expect = 2e-24
 Identities = 57/82 (69%), Positives = 63/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT--S 683
           AYFNDSQRQATKDAG+I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 207

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
           +  S+        +   GDTHL
Sbjct: 208 SVLSIDEGSLFEVKATAGDTHL 229



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 36/56 (64%), Positives = 47/56 (83%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++ GKPKI+V +KGE K F PEE+SSMVLTKM+E AE YLG  V++AV+TVP
Sbjct: 92  FKVINEKGKPKIEVEFKGERKRFAPEEISSMVLTKMREIAEVYLGGKVKDAVVTVP 147



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           NT+FDAKRLIGRKF+D  +Q D+K WPF++   +   +     + + K F+P +
Sbjct: 65  NTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEE 118


>AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA
           protein.
          Length = 633

 Score =  113 bits (271), Expect = 3e-25
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 M 254
           M
Sbjct: 61  M 61



 Score =  110 bits (264), Expect = 2e-24
 Identities = 57/82 (69%), Positives = 63/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT--S 683
           AYFNDSQRQATKDAG+I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 207

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
           +  S+        +   GDTHL
Sbjct: 208 SVLSIDEGSLFEVKATAGDTHL 229



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 36/56 (64%), Positives = 47/56 (83%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+++ GKPKI+V +KGE K F PEE+SSMVLTKM+E AE YLG  V++AV+TVP
Sbjct: 92  FKVINEKGKPKIEVEFKGERKRFAPEEISSMVLTKMREIAEVYLGGKVKDAVVTVP 147



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           NT+FDAKRLIGRKF+D  +Q D+K WPF++   +   +     + + K F+P +
Sbjct: 65  NTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEE 118


>AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock
           protein hsp70Bb protein.
          Length = 55

 Score =  112 bits (269), Expect = 6e-25
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQ 55


>J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1
           protein protein.
          Length = 641

 Score =  109 bits (263), Expect = 3e-24
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEI A DQGNRTTPSYVAFTD+ERL G+ AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEINAYDQGNRTTPSYVAFTDSERLNGEPAKNQVAMNP 60



 Score =  108 bits (260), Expect = 7e-24
 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGT   
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDV 204

Query: 690 PSLPSRRYLRGEIH--RGDTHL 749
             L        E+    GDTHL
Sbjct: 205 SILTIDEGSLFEVRSTAGDTHL 226



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVSDGGKPKI V YKGE K F PEE+SSMVLTKMKETAEAYLG+++ +AVITVP
Sbjct: 89  FKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVP 144



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRK++D  +  DMKHWPF++
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKV 91


>L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock
           protein cognate 72 protein.
          Length = 656

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p
           protein.
          Length = 655

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD,
           isoform D protein.
          Length = 656

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC,
           isoform C protein.
          Length = 656

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB,
           isoform B protein.
          Length = 656

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA,
           isoform A protein.
          Length = 656

 Score =  102 bits (245), Expect = 5e-22
 Identities = 54/81 (66%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 6e-21
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 34/56 (60%), Positives = 39/56 (69%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP I V      K F PEE+S+MVL KMKETAEAYLGK V +AV+TVP
Sbjct: 118 FKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKT----KPFSPR 421
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+  V+E N  S+ HI V T    K F+P 
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFK--VVEKN--SKPHISVDTSQGAKVFAPE 143

Query: 422 K 424
           +
Sbjct: 144 E 144


>L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock
           protein cognate 71 protein.
          Length = 687

 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 42/57 (73%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGT 249



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (2%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYS 275
            +  T Y+
Sbjct: 111 NSANTFYA 118



 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 20/38 (52%), Positives = 28/38 (73%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + P ++ + +L KMKETAEAYL   V+NAV+TVP
Sbjct: 157 DGKVYSPSQIGAFILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT +  KRLIGR+F+D  V+ D+ +  +++
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKV 143


>AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p
           protein.
          Length = 686

 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 42/57 (73%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGT 249



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (2%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYS 275
            +  T Y+
Sbjct: 111 NSANTFYA 118



 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 20/38 (52%), Positives = 28/38 (73%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + P ++ + +L KMKETAEAYL   V+NAV+TVP
Sbjct: 157 DGKVYSPSQIGAFILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT +  KRLIGR+F+D  V+ D+ +  +++
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKV 143


>AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA
           protein.
          Length = 686

 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 42/57 (73%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGT 249



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (2%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYS 275
            +  T Y+
Sbjct: 111 NSANTFYA 118



 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 20/38 (52%), Positives = 28/38 (73%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + P ++ + +L KMKETAEAYL   V+NAV+TVP
Sbjct: 157 DGKVYSPSQIGAFILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT +  KRLIGR+F+D  V+ D+ +  +++
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKV 143


>J02569-1|AAA28631.1|  104|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 88E
           (partial). ).
          Length = 104

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 41/64 (64%), Positives = 43/64 (67%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGV                    YVAFTDTERLIGDAAKN+VA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGV--------------------YVAFTDTERLIGDAAKNEVA 40

Query: 252 MTPT 263
           M PT
Sbjct: 41  MNPT 44



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 31/53 (58%), Positives = 39/53 (73%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPF 412
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFE  V+ A+ + +    +K  PF
Sbjct: 42  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFE--VVSADGKPKIESDMKHWPF 92


>AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock
           protein cognate 70Cb protein.
          Length = 804

 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 64/209 (30%), Positives = 91/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G++E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGEIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145



 Score = 29.1 bits (62), Expect = 6.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWP 343
           NT+   KRL+GRKF D  VQ ++   P
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIP 88


>V00213-1|CAA23495.1|  149|Drosophila melanogaster protein (
           Drosophila melanogastergene coding for heat shock
           protein 70. ).
          Length = 149

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/29 (93%), Positives = 29/29 (100%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQ 170
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQ 30



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKET-AEAYLGKTVQNAVITVPRTSMT 525
           K +I V YKGE K F PEE+SSMVLTKMKET AEAYLG++ Q        TS T
Sbjct: 96  KAQIGVEYKGESKRFAPEEISSMVLTKMKETAAEAYLGESPQTQSSQFQPTSTT 149



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 23/57 (40%), Positives = 35/57 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT F AKRLIGRK++D  +  DMKHWPF+        +     + ++K F+P +
Sbjct: 58  NPSNTAFHAKRLIGRKYDDPKIAEDMKHWPFKAGKRRRKAQIGVEYKGESKRFAPEE 114


>AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p
           protein.
          Length = 804

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 64/209 (30%), Positives = 90/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G +E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145



 Score = 29.1 bits (62), Expect = 6.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWP 343
           NT+   KRL+GRKF D  VQ ++   P
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIP 88


>AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC,
           isoform C protein.
          Length = 804

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 64/209 (30%), Positives = 90/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G +E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145



 Score = 29.1 bits (62), Expect = 6.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWP 343
           NT+   KRL+GRKF D  VQ ++   P
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIP 88


>AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB,
           isoform B protein.
          Length = 804

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 64/209 (30%), Positives = 90/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G +E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145



 Score = 29.1 bits (62), Expect = 6.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWP 343
           NT+   KRL+GRKF D  VQ ++   P
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIP 88


>AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA,
           isoform A protein.
          Length = 804

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 64/209 (30%), Positives = 90/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G +E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145



 Score = 29.1 bits (62), Expect = 6.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWP 343
           NT+   KRL+GRKF D  VQ ++   P
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIP 88


>AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p
           protein.
          Length = 923

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQY 272
           P + Y
Sbjct: 80  PNSAY 84



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 653
           Q   EC      YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 654 --LIFDLG 671
             L +D+G
Sbjct: 214 YFLFYDMG 221


>AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1
           protein.
          Length = 923

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQY 272
           P + Y
Sbjct: 80  PNSAY 84



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 653
           Q   EC      YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 654 --LIFDLG 671
             L +D+G
Sbjct: 214 YFLFYDMG 221


>AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA
           protein.
          Length = 923

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQY 272
           P + Y
Sbjct: 80  PNSAY 84



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 653
           Q   EC      YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 654 --LIFDLG 671
             L +D+G
Sbjct: 214 YFLFYDMG 221


>AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p
           protein.
          Length = 513

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGG 674
           +Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T + R+VL    GG
Sbjct: 161 SYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGG 216



 Score = 35.1 bits (77), Expect = 0.10
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMT 257
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 258 P 260
           P
Sbjct: 63  P 63


>AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA
           protein.
          Length = 513

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGG 674
           +Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T + R+VL    GG
Sbjct: 161 SYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGG 216



 Score = 35.1 bits (77), Expect = 0.10
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMT 257
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 258 P 260
           P
Sbjct: 63  P 63


>AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.
          Length = 46

 Score = 36.3 bits (80), Expect = 0.045
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 218
           +GID G     V   + G++E +AND   R T S+VAF   +R
Sbjct: 4   IGIDFGNESCYVAARRSGEIETLANDYSLRATRSFVAFDGKKR 46


>BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p
           protein.
          Length = 342

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -2

Query: 221 ETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRG 108
           +T  + +  +   GP  +V+  DLH P++ DTN  + G
Sbjct: 125 DTENLIKNTLPPEGPSKIVLPGDLHTPIIPDTNEVING 162


>AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-PA
           protein.
          Length = 118

 Score = 28.7 bits (61), Expect = 8.9
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = -2

Query: 281 WHRILCCWGHRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQ 102
           WHR+ C W  + L + G  D T   C       G +++ +  D H+P     N+   G Q
Sbjct: 58  WHRVDCAW--KLLQMQG--DGTFASCNDG---QGHLSVFLATDNHIPTRSLNNSSAFGIQ 110

Query: 101 IDSYC 87
            +  C
Sbjct: 111 RNGTC 115


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,229,071
Number of Sequences: 53049
Number of extensions: 902504
Number of successful extensions: 3267
Number of sequences better than 10.0: 157
Number of HSP's better than 10.0 without gapping: 2521
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3127
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3417159966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -