SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock pro...   165   8e-41
BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p pro...   165   8e-41
AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF...   165   8e-41
AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE...   165   8e-41
AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD...   165   8e-41
AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC...   165   8e-41
AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB...   165   8e-41
AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA...   165   8e-41
L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock pro...   164   1e-40
BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p pro...   164   1e-40
AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD...   164   1e-40
AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC...   164   1e-40
AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA...   164   1e-40
BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p pro...   164   1e-40
AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p pro...   163   2e-40
M36114-1|AAA28627.1|  651|Drosophila melanogaster protein ( D.me...   159   4e-39
AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1...   151   1e-36
J01103-1|AAA28640.1|  643|Drosophila melanogaster protein ( D.me...   151   1e-36
BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p pro...   151   1e-36
BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p pro...   151   1e-36
BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p pro...   151   1e-36
BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p pro...   151   1e-36
AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb prot...   151   1e-36
AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p pro...   151   1e-36
AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock p...   151   1e-36
AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock p...   151   1e-36
AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock p...   151   1e-36
AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA...   151   1e-36
AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA...   151   1e-36
AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-P...   151   1e-36
AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-P...   151   1e-36
AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-P...   151   1e-36
AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-P...   151   1e-36
BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p pro...   150   2e-36
AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA...   150   2e-36
AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock p...   149   4e-36
AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock p...   149   4e-36
AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock p...   148   7e-36
AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock p...   148   7e-36
AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock p...   148   9e-36
AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock p...   148   9e-36
AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA...   148   9e-36
L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock pro...   144   2e-34
BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p pro...   144   2e-34
AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD...   144   2e-34
AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC...   144   2e-34
AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB...   144   2e-34
AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA...   144   2e-34
L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock pro...   130   2e-30
AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p pro...   130   2e-30
AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA...   130   2e-30
J01085-1|AAA28629.1|   68|Drosophila melanogaster protein ( Dros...   122   7e-28
BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p pro...   122   7e-28
AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock p...   116   3e-26
AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock p...   116   3e-26
AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock p...   116   3e-26
AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock p...   112   6e-25
K01297-1|AAA28630.1|   68|Drosophila melanogaster protein ( D.me...   111   1e-24
V00213-1|CAA23495.1|  149|Drosophila melanogaster protein ( Dros...   110   2e-24
J02569-1|AAA28631.1|  104|Drosophila melanogaster protein ( D.me...    81   2e-15
AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p pro...    70   3e-12
AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock pr...    70   3e-12
AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC...    70   3e-12
AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB...    70   3e-12
AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA...    70   3e-12
AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p pro...    54   3e-07
AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA...    54   3e-07
AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p pro...    46   6e-05
AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1 pr...    46   6e-05
AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA ...    46   6e-05
AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.     36   0.045
BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p pro...    31   1.7  
BT015191-1|AAT94420.1|  410|Drosophila melanogaster RH35908p pro...    30   3.9  
AY069728-1|AAL39873.1|  245|Drosophila melanogaster LP03146p pro...    29   6.9  
AE013599-1733|AAF58364.1|  611|Drosophila melanogaster CG13330-P...    29   6.9  
S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription ...    29   9.1  
BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p pro...    29   9.1  
BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p pro...    29   9.1  
AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-P...    29   9.1  
AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA...    29   9.1  
AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC...    29   9.1  
AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB...    29   9.1  
AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcripti...    29   9.1  

>L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p
           protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF,
           isoform F protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE,
           isoform E protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD,
           isoform D protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC,
           isoform C protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB,
           isoform B protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA,
           isoform A protein.
          Length = 651

 Score =  165 bits (400), Expect = 8e-41
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 641

 Score =  164 bits (399), Expect = 1e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 206 DVSVLTIEDGIFEVKATAGDTHLG 229



 Score =  151 bits (367), Expect = 8e-37
 Identities = 67/87 (77%), Positives = 80/87 (91%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NPNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVS
Sbjct: 61  MNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM+ETAEAYLG TV +AV+T P
Sbjct: 121 SMVLTKMRETAEAYLGGTVTDAVVTVP 147



 Score =  122 bits (293), Expect = 7e-28
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p
           protein.
          Length = 555

 Score =  164 bits (399), Expect = 1e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 60  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 119

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 120 DVSVLTIEDGIFEVKATAGDTHLG 143



 Score =  103 bits (246), Expect = 3e-22
 Identities = 45/61 (73%), Positives = 54/61 (88%)
 Frame = +2

Query: 332 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITF 511
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+T 
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTV 60

Query: 512 P 514
           P
Sbjct: 61  P 61


>AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD,
           isoform D protein.
          Length = 555

 Score =  164 bits (399), Expect = 1e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 60  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 119

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 120 DVSVLTIEDGIFEVKATAGDTHLG 143



 Score =  103 bits (246), Expect = 3e-22
 Identities = 45/61 (73%), Positives = 54/61 (88%)
 Frame = +2

Query: 332 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITF 511
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+T 
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTV 60

Query: 512 P 514
           P
Sbjct: 61  P 61


>AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC,
           isoform C protein.
          Length = 555

 Score =  164 bits (399), Expect = 1e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 60  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 119

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 120 DVSVLTIEDGIFEVKATAGDTHLG 143



 Score =  103 bits (246), Expect = 3e-22
 Identities = 45/61 (73%), Positives = 54/61 (88%)
 Frame = +2

Query: 332 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITF 511
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG TV +AV+T 
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTV 60

Query: 512 P 514
           P
Sbjct: 61  P 61


>AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA,
           isoform A protein.
          Length = 641

 Score =  164 bits (399), Expect = 1e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 206 DVSVLTIEDGIFEVKATAGDTHLG 229



 Score =  151 bits (367), Expect = 8e-37
 Identities = 67/87 (77%), Positives = 80/87 (91%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NPNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVS
Sbjct: 61  MNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM+ETAEAYLG TV +AV+T P
Sbjct: 121 SMVLTKMRETAEAYLGGTVTDAVVTVP 147



 Score =  122 bits (293), Expect = 7e-28
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p
           protein.
          Length = 680

 Score =  164 bits (398), Expect = 1e-40
 Identities = 76/84 (90%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDLGGGTF
Sbjct: 185 IPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTF 244

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVK+TAGDTH G
Sbjct: 245 DVSVLTIEDGIFEVKATAGDTHLG 268



 Score =  152 bits (368), Expect = 6e-37
 Identities = 67/87 (77%), Positives = 80/87 (91%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NPNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVS
Sbjct: 100 MNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVS 159

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM+ETAEAYLG TV +AV+T P
Sbjct: 160 SMVLTKMRETAEAYLGGTVTDAVVTIP 186



 Score =  124 bits (298), Expect = 2e-28
 Identities = 58/64 (90%), Positives = 60/64 (93%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           KM K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQV
Sbjct: 39  KMPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQV 98

Query: 252 A*TP 263
           A  P
Sbjct: 99  AMNP 102


>AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p
           protein.
          Length = 651

 Score =  163 bits (396), Expect = 2e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEV+STAGDTH G
Sbjct: 206 DVSILSIDDGIFEVQSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>M36114-1|AAA28627.1|  651|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 4 (hsc4) gene, exon 2.
           ).
          Length = 651

 Score =  159 bits (386), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+G NV RIINEPTAAAIAYGLDKK  GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGPNVPRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL+I+DGIFEVKSTAGDTH G
Sbjct: 206 DVSILSIDDGIFEVKSTAGDTHLG 229



 Score =  155 bits (375), Expect = 8e-38
 Identities = 72/87 (82%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+S
Sbjct: 61  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLGKTV NAVIT P
Sbjct: 121 SMVLTKMKETAEAYLGKTVTNAVITVP 147



 Score =  130 bits (313), Expect = 3e-30
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (343), Expect = 6e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRRYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+ + +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGEGITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (366), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLNGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1
           protein protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  106 bits (254), Expect = 4e-23
 Identities = 49/59 (83%), Positives = 53/59 (89%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEI A DQGNRTTPSYVAFTD+ERL G+ AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEINAYDQGNRTTPSYVAFTDSERLNGEPAKNQVAMNP 60


>J01103-1|AAA28640.1|  643|Drosophila melanogaster protein (
           D.melanogaster heatshock protein 70 genes, locus 87A7,
           seg. 2. (partial proximalgene, spacer region and
           complete distal gene). ).
          Length = 643

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 144 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 203

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 204 DVSILTIDEGSLFEVRSTAGDTHLG 228



 Score =  140 bits (338), Expect = 2e-33
 Identities = 64/88 (72%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKET-AEAYLGKTVQNAVITFP 514
           SMVLTKMKET AEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAAEAYLGESITDAVITVP 145



 Score =  115 bits (276), Expect = 8e-26
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIG+ AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGEPAKNQVAMNP 60


>BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p
           protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (344), Expect = 5e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRL GRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLTGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (344), Expect = 5e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FD KRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDPKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p
           protein.
          Length = 635

 Score =  151 bits (365), Expect = 1e-36
 Identities = 72/85 (84%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  139 bits (337), Expect = 3e-33
 Identities = 60/87 (68%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+S
Sbjct: 58  MNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG TV++AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score =  117 bits (282), Expect = 2e-26
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60


>AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  115 bits (276), Expect = 8e-26
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60


>AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  113 bits (273), Expect = 2e-25
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  113 bits (273), Expect = 2e-25
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  114 bits (274), Expect = 1e-25
 Identities = 52/59 (88%), Positives = 55/59 (93%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ RLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSARLIGDPAKNQVAMNP 60


>AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  115 bits (276), Expect = 8e-26
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60


>AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (345), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETA+AYLG+++  AVIT P
Sbjct: 118 SMVLTKMKETADAYLGESITGAVITVP 144



 Score =  115 bits (276), Expect = 8e-26
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60


>AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (345), Expect = 4e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETA+AYLG+++  AVIT P
Sbjct: 118 SMVLTKMKETADAYLGESITGAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  141 bits (342), Expect = 8e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAK LIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKGLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  142 bits (343), Expect = 6e-34
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VV DGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVIDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  141 bits (341), Expect = 1e-33
 Identities = 63/87 (72%), Positives = 74/87 (85%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +N  NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNSRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  115 bits (277), Expect = 6e-26
 Identities = 52/56 (92%), Positives = 55/56 (98%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVA 57


>AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock
           protein 68 protein.
          Length = 635

 Score =  151 bits (365), Expect = 1e-36
 Identities = 72/85 (84%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  139 bits (337), Expect = 3e-33
 Identities = 60/87 (68%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+S
Sbjct: 58  MNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG TV++AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score =  117 bits (282), Expect = 2e-26
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60


>AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA
           protein.
          Length = 635

 Score =  151 bits (365), Expect = 1e-36
 Identities = 72/85 (84%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  139 bits (337), Expect = 3e-33
 Identities = 60/87 (68%), Positives = 76/87 (87%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+S
Sbjct: 58  MNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG TV++AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGTTVKDAVITVP 144



 Score =  117 bits (282), Expect = 2e-26
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 60


>AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-PA
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-PA
           protein.
          Length = 641

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-PA
           protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-PA
           protein.
          Length = 642

 Score =  151 bits (365), Expect = 1e-36
 Identities = 73/85 (85%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p
           protein.
          Length = 633

 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/85 (83%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG+I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVS+L+I++G +FEVK+TAGDTH G
Sbjct: 206 DVSVLSIDEGSLFEVKATAGDTHLG 230



 Score =  125 bits (301), Expect = 8e-29
 Identities = 55/87 (63%), Positives = 71/87 (81%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +N  NT+FDAKRLIGRKF+D  +Q D+K WPF+V+++ GKPKI+V +KGE K F PEE+S
Sbjct: 61  MNAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM+E AE YLG  V++AV+T P
Sbjct: 121 SMVLTKMREIAEVYLGGKVKDAVVTVP 147



 Score =  111 bits (266), Expect = 1e-24
 Identities = 51/60 (85%), Positives = 55/60 (91%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60


>AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA
           protein.
          Length = 633

 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/85 (83%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG+I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVS+L+I++G +FEVK+TAGDTH G
Sbjct: 206 DVSVLSIDEGSLFEVKATAGDTHLG 230



 Score =  125 bits (301), Expect = 8e-29
 Identities = 55/87 (63%), Positives = 71/87 (81%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +N  NT+FDAKRLIGRKF+D  +Q D+K WPF+V+++ GKPKI+V +KGE K F PEE+S
Sbjct: 61  MNAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM+E AE YLG  V++AV+T P
Sbjct: 121 SMVLTKMREIAEVYLGGKVKDAVVTVP 147



 Score =  111 bits (266), Expect = 1e-24
 Identities = 51/60 (85%), Positives = 55/60 (91%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60


>AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  149 bits (361), Expect = 4e-36
 Identities = 72/85 (84%), Positives = 79/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIF+LGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFELGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  113 bits (273), Expect = 2e-25
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  149 bits (361), Expect = 4e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI +G +FEV+STAGDTH G
Sbjct: 203 DVSILTIYEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  148 bits (359), Expect = 7e-36
 Identities = 72/85 (84%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLI DLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLILDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  148 bits (359), Expect = 7e-36
 Identities = 72/85 (84%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLI DLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLILDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  148 bits (358), Expect = 9e-36
 Identities = 72/85 (84%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   G RNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGGRNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  148 bits (358), Expect = 9e-36
 Identities = 72/85 (84%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVL FDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLNFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA
           protein.
          Length = 641

 Score =  148 bits (358), Expect = 9e-36
 Identities = 72/85 (84%), Positives = 78/85 (91%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK    ERNVLIFDLGGGTF
Sbjct: 143 VPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKDERNVLIFDLGGGTF 202

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI++G +FEV+STAGDTH G
Sbjct: 203 DVSILTIDEGSLFEVRSTAGDTHLG 227



 Score =  144 bits (349), Expect = 1e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+S
Sbjct: 58  MNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG+++ +AVIT P
Sbjct: 118 SMVLTKMKETAEAYLGESITDAVITVP 144



 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock
           protein cognate 72 protein.
          Length = 656

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p
           protein.
          Length = 655

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD,
           isoform D protein.
          Length = 656

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC,
           isoform C protein.
          Length = 656

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB,
           isoform B protein.
          Length = 656

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA,
           isoform A protein.
          Length = 656

 Score =  144 bits (348), Expect = 2e-34
 Identities = 67/84 (79%), Positives = 77/84 (91%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYGLDKK  GE+NVL+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKK-EGEKNVLVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  108 bits (259), Expect = 9e-24
 Identities = 52/86 (60%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEAYLGK V +AV+T P
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP 89


>L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock
           protein cognate 71 protein.
          Length = 687

 Score =  130 bits (315), Expect = 2e-30
 Identities = 61/84 (72%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTLLG 274



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 35/86 (40%), Positives = 51/86 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT +  KRLIGR+F+D  V+ D+ +  ++VV          +  G  K + P ++ +
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDG--KVYSPSQIGA 168

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L KMKETAEAYL   V+NAV+T P
Sbjct: 169 FILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQ 107


>AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p
           protein.
          Length = 686

 Score =  130 bits (315), Expect = 2e-30
 Identities = 61/84 (72%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTLLG 274



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 35/86 (40%), Positives = 51/86 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT +  KRLIGR+F+D  V+ D+ +  ++VV          +  G  K + P ++ +
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDG--KVYSPSQIGA 168

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L KMKETAEAYL   V+NAV+T P
Sbjct: 169 FILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQ 107


>AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA
           protein.
          Length = 686

 Score =  130 bits (315), Expect = 2e-30
 Identities = 61/84 (72%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK  T ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTLLG 274



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 35/86 (40%), Positives = 51/86 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT +  KRLIGR+F+D  V+ D+ +  ++VV          +  G  K + P ++ +
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDG--KVYSPSQIGA 168

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L KMKETAEAYL   V+NAV+T P
Sbjct: 169 FILMKMKETAEAYLNTPVKNAVVTVP 194



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQ 107


>J01085-1|AAA28629.1|   68|Drosophila melanogaster protein (
           Drosophila melanogasterheat shock cognate (hsc70) gene
           (locus 70C), exon 1. ).
          Length = 68

 Score =  122 bits (293), Expect = 7e-28
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p
           protein.
          Length = 73

 Score =  122 bits (293), Expect = 7e-28
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 64

 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  116 bits (280), Expect = 3e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVA  P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock
           protein hsp70Bb protein.
          Length = 55

 Score =  112 bits (269), Expect = 6e-25
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQ 55


>K01297-1|AAA28630.1|   68|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 87D:
           exon 2. (partial). ).
          Length = 68

 Score =  111 bits (266), Expect = 1e-24
 Identities = 51/60 (85%), Positives = 55/60 (91%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60


>V00213-1|CAA23495.1|  149|Drosophila melanogaster protein (
           Drosophila melanogastergene coding for heat shock
           protein 70. ).
          Length = 149

 Score =  110 bits (264), Expect = 2e-24
 Identities = 55/93 (59%), Positives = 65/93 (69%), Gaps = 1/93 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT F AKRLIGRK++D  +  DMKHWPF+      K +I V YKGE K F PEE+S
Sbjct: 57  LNPSNTAFHAKRLIGRKYDDPKIAEDMKHWPFKAGKRRRKAQIGVEYKGESKRFAPEEIS 116

Query: 434 SMVLTKMKET-AEAYLGKTVQNAVITFPRTSMT 529
           SMVLTKMKET AEAYLG++ Q     F  TS T
Sbjct: 117 SMVLTKMKETAAEAYLGESPQTQSSQFQPTSTT 149



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/29 (93%), Positives = 29/29 (100%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQ 173
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQ 30


>J02569-1|AAA28631.1|  104|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 88E
           (partial). ).
          Length = 104

 Score = 81.0 bits (191), Expect = 2e-15
 Identities = 35/44 (79%), Positives = 39/44 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 385
           +NP  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+
Sbjct: 41  MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIE 84



 Score = 66.5 bits (155), Expect = 4e-11
 Identities = 40/64 (62%), Positives = 42/64 (65%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+KAPAVGIDLGTTYSCVGV                    YVAFTDTERLIGDAAKN+VA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGV--------------------YVAFTDTERLIGDAAKNEVA 40

Query: 255 *TPT 266
             PT
Sbjct: 41  MNPT 44


>AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p
           protein.
          Length = 804

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock
           protein cognate 70Cb protein.
          Length = 804

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/52 (48%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G++E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGEIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC,
           isoform C protein.
          Length = 804

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB,
           isoform B protein.
          Length = 804

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA,
           isoform A protein.
          Length = 804

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p
           protein.
          Length = 513

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           +P+Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T + R+VL    GG  
Sbjct: 159 IPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLY 218

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
            D++  ++++G+F   +T G    G
Sbjct: 219 SDIAFYSVQNGLFVQLATFGPFPIG 243



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*T 260
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 261 P 263
           P
Sbjct: 63  P 63


>AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA
           protein.
          Length = 513

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           +P+Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T + R+VL    GG  
Sbjct: 159 IPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLY 218

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
            D++  ++++G+F   +T G    G
Sbjct: 219 SDIAFYSVQNGLFVQLATFGPFPIG 243



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*T 260
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 261 P 263
           P
Sbjct: 63  P 63


>AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p
           protein.
          Length = 923

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 657
           Q   EC   VP YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 658 --LIFDLGGGTFDVSILTIE 711
             L +D+G      ++++ +
Sbjct: 214 YFLFYDMGAYKTSAAVVSYQ 233



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 261 PTTQY 275
           P + Y
Sbjct: 80  PNSAY 84



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPF-EVVSDGGKPKIKVAYKGEDKTF 415
           Q  G  +PN+       L+G+  ++  V    K +P+  +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
             EE+ + +L K K+ A+  + + +   V+T P
Sbjct: 132 SVEELVAQLLVKAKQFAQESVQQPITECVLTVP 164


>AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1
           protein.
          Length = 923

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 657
           Q   EC   VP YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 658 --LIFDLGGGTFDVSILTIE 711
             L +D+G      ++++ +
Sbjct: 214 YFLFYDMGAYKTSAAVVSYQ 233



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 261 PTTQY 275
           P + Y
Sbjct: 80  PNSAY 84



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPF-EVVSDGGKPKIKVAYKGEDKTF 415
           Q  G  +PN+       L+G+  ++  V    K +P+  +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
             EE+ + +L K K+ A+  + + +   V+T P
Sbjct: 132 SVEELVAQLLVKAKQFAQESVQQPITECVLTVP 164


>AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA
           protein.
          Length = 923

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 657
           Q   EC   VP YF  ++R+A   A  ++ L VL++IN+  A A+ YG+  +G       
Sbjct: 154 QPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQ 213

Query: 658 --LIFDLGGGTFDVSILTIE 711
             L +D+G      ++++ +
Sbjct: 214 YFLFYDMGAYKTSAAVVSYQ 233



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 261 PTTQY 275
           P + Y
Sbjct: 80  PNSAY 84



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPF-EVVSDGGKPKIKVAYKGEDKTF 415
           Q  G  +PN+       L+G+  ++  V    K +P+  +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
             EE+ + +L K K+ A+  + + +   V+T P
Sbjct: 132 SVEELVAQLLVKAKQFAQESVQQPITECVLTVP 164


>AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.
          Length = 46

 Score = 36.3 bits (80), Expect = 0.045
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 221
           +GID G     V   + G++E +AND   R T S+VAF   +R
Sbjct: 4   IGIDFGNESCYVAARRSGEIETLANDYSLRATRSFVAFDGKKR 46


>BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p
           protein.
          Length = 342

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -2

Query: 224 ETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRG 111
           +T  + +  +   GP  +V+  DLH P++ DTN  + G
Sbjct: 125 DTENLIKNTLPPEGPSKIVLPGDLHTPIIPDTNEVING 162


>BT015191-1|AAT94420.1|  410|Drosophila melanogaster RH35908p
           protein.
          Length = 410

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 4/77 (5%)
 Frame = -1

Query: 447 VSTMELTSSGKKVLSSPLYATLILGL--PPSLTTSKGQCFMSACTVASS--NLRPMRRLA 280
           +S+  LT+ G+     P     +  +  PP  + SKG+C  +  T + S  N R     A
Sbjct: 1   MSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTHEAA 60

Query: 279 SNIVLLGFTPPGSWRHL 229
           +    + F P G   H+
Sbjct: 61  NGAARIEFVPTGVGTHV 77


>AY069728-1|AAL39873.1|  245|Drosophila melanogaster LP03146p
           protein.
          Length = 245

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%)
 Frame = +1

Query: 157 SSPTTRATGPLRLMLRSQTPSVSSEMP---PRTRWREPQQHNIRCQTS 291
           SS T   T P  L   S +PS SSE P   P +R   P + + RC +S
Sbjct: 68  SSATRSLTPPPILTRNSSSPSPSSEAPSSTPTSRSSSPNRRSNRCFSS 115


>AE013599-1733|AAF58364.1|  611|Drosophila melanogaster CG13330-PA
           protein.
          Length = 611

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%)
 Frame = +1

Query: 157 SSPTTRATGPLRLMLRSQTPSVSSEMP---PRTRWREPQQHNIRCQTS 291
           SS T   T P  L   S +PS SSE P   P +R   P + + RC +S
Sbjct: 434 SSATRSLTPPPILTRNSSSPSPSSEAPSSTPTSRSSSPNRRSNRCFSS 481


>S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription
           factor TFIID 230kda subunit protein.
          Length = 2068

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 411 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 445


>BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p
           protein.
          Length = 1964

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p
           protein.
          Length = 2096

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-PA
           protein.
          Length = 118

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = -2

Query: 284 WHRILCCWGSRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQ 105
           WHR+ C W  + L + G  D T   C       G +++ +  D H+P     N+   G Q
Sbjct: 58  WHRVDCAW--KLLQMQG--DGTFASCNDG---QGHLSVFLATDNHIPTRSLNNSSAFGIQ 110

Query: 104 IDSYC 90
            +  C
Sbjct: 111 RNGTC 115


>AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA,
           isoform A protein.
          Length = 2065

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC,
           isoform C protein.
          Length = 2098

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB,
           isoform B protein.
          Length = 2129

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcription
           factor protein.
          Length = 2065

 Score = 28.7 bits (61), Expect = 9.1
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 412
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,253,475
Number of Sequences: 53049
Number of extensions: 896333
Number of successful extensions: 3212
Number of sequences better than 10.0: 167
Number of HSP's better than 10.0 without gapping: 2603
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3077
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3478915869
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -