SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT010009-1|AAQ22478.1| 2051|Drosophila melanogaster RE22882p pro...   132   3e-31
AF106933-1|AAD09426.1| 2051|Drosophila melanogaster plexin B pro...   132   3e-31
AE014135-2|AAF59374.2| 2051|Drosophila melanogaster CG17245-PA p...   132   3e-31
AF106932-1|AAD09425.1| 1945|Drosophila melanogaster plexin A pro...    86   5e-17
AE014135-165|AAN06564.1| 1505|Drosophila melanogaster CG11081-PC...    86   5e-17
AE014135-164|AAN06563.1| 1505|Drosophila melanogaster CG11081-PB...    86   5e-17
AE014135-163|AAN06565.2| 1945|Drosophila melanogaster CG11081-PD...    86   5e-17
AE014135-162|AAF59394.1| 1945|Drosophila melanogaster CG11081-PA...    86   5e-17
AF433841-1|AAM17992.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433840-1|AAM17991.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433839-1|AAM17990.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433838-1|AAM17989.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433837-1|AAM17988.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433836-1|AAM17987.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433835-1|AAM17986.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433834-1|AAM17985.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433833-1|AAM17984.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AF433832-1|AAM17983.1|  278|Drosophila melanogaster plexin A pro...    31   1.4  
AE014134-2552|AAN10885.1|  187|Drosophila melanogaster CG31832-P...    30   2.5  
AE014134-701|AAF51040.2|  387|Drosophila melanogaster CG11767-PA...    30   3.3  
BT011113-1|AAR82780.1| 1877|Drosophila melanogaster LD22358p pro...    29   5.8  
AY069489-1|AAL39634.1|  973|Drosophila melanogaster LD21888p pro...    29   5.8  
AF322889-1|AAG42828.1| 1870|Drosophila melanogaster integral mem...    29   5.8  
AE014296-1931|AAF50078.1|  973|Drosophila melanogaster CG6190-PA...    29   5.8  
AE013599-106|AAF57309.2| 1876|Drosophila melanogaster CG7897-PA ...    29   5.8  
AF210453-1|AAF21041.1| 4559|Drosophila melanogaster dynein heavy...    29   7.7  

>BT010009-1|AAQ22478.1| 2051|Drosophila melanogaster RE22882p protein.
          Length = 2051

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/82 (75%), Positives = 73/82 (89%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            FLLFKAIKHQIEKG+VDAIT++ARYSLSEE+LL EQ+ +  V LHI+QD+ DEKVQC+V 
Sbjct: 1601 FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN 1660

Query: 191  DCDSISQVKSKILDALFKNTPF 256
            D D+ISQVK KILDA+FKNTPF
Sbjct: 1661 DWDTISQVKLKILDAIFKNTPF 1682



 Score =  130 bits (313), Expect = 2e-30
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S+RP+V+EVDLEWRHGRGGH+TLQDED+TTKT+NGW++LNTLAHYGVKESA+MSLI+RQN
Sbjct: 1683 SMRPSVNEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQN 1742

Query: 436  DSFNTPY-----KIPCKNCTGIYCSNSHI 507
            D+++ PY       P  N   I  S SHI
Sbjct: 1743 DNYHIPYSKNQNSAPYHNFYFINNSQSHI 1771


>AF106933-1|AAD09426.1| 2051|Drosophila melanogaster plexin B protein.
          Length = 2051

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/82 (75%), Positives = 73/82 (89%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            FLLFKAIKHQIEKG+VDAIT++ARYSLSEE+LL EQ+ +  V LHI+QD+ DEKVQC+V 
Sbjct: 1601 FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN 1660

Query: 191  DCDSISQVKSKILDALFKNTPF 256
            D D+ISQVK KILDA+FKNTPF
Sbjct: 1661 DWDTISQVKLKILDAIFKNTPF 1682



 Score =  127 bits (307), Expect = 1e-29
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S++P+V+E+DLEWRHGRGGH+TLQDED+TTKT+NGW++LNTLAHYGVKESA+MSLI+RQN
Sbjct: 1683 SMKPSVNELDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQN 1742

Query: 436  DSFNTPY-----KIPCKNCTGIYCSNSHI 507
            D+++ PY       P  N   I  S SHI
Sbjct: 1743 DNYHIPYSKNQNSAPYHNFYFINNSQSHI 1771


>AE014135-2|AAF59374.2| 2051|Drosophila melanogaster CG17245-PA
            protein.
          Length = 2051

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/82 (75%), Positives = 73/82 (89%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            FLLFKAIKHQIEKG+VDAIT++ARYSLSEE+LL EQ+ +  V LHI+QD+ DEKVQC+V 
Sbjct: 1601 FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN 1660

Query: 191  DCDSISQVKSKILDALFKNTPF 256
            D D+ISQVK KILDA+FKNTPF
Sbjct: 1661 DWDTISQVKLKILDAIFKNTPF 1682



 Score =  130 bits (313), Expect = 2e-30
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S+RP+V+EVDLEWRHGRGGH+TLQDED+TTKT+NGW++LNTLAHYGVKESA+MSLI+RQN
Sbjct: 1683 SMRPSVNEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQN 1742

Query: 436  DSFNTPY-----KIPCKNCTGIYCSNSHI 507
            D+++ PY       P  N   I  S SHI
Sbjct: 1743 DNYHIPYSKNQNSAPYHNFYFINNSQSHI 1771


>AF106932-1|AAD09425.1| 1945|Drosophila melanogaster plexin A protein.
          Length = 1945

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1498 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1557

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1558 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1591



 Score = 73.3 bits (172), Expect = 3e-13
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1593 SPRPPKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1652

Query: 436  DSFN 447
              +N
Sbjct: 1653 SIYN 1656



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516  NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
            N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 1693 NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 1731


>AE014135-165|AAN06564.1| 1505|Drosophila melanogaster CG11081-PC,
            isoform C protein.
          Length = 1505

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1058 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1117

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1118 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1151



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1153 SQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1212

Query: 436  DSFN 447
              +N
Sbjct: 1213 SIYN 1216



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516  NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
            N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 1253 NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 1291


>AE014135-164|AAN06563.1| 1505|Drosophila melanogaster CG11081-PB,
            isoform B protein.
          Length = 1505

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1058 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1117

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1118 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1151



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1153 SQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1212

Query: 436  DSFN 447
              +N
Sbjct: 1213 SIYN 1216



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516  NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
            N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 1253 NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 1291


>AE014135-163|AAN06565.2| 1945|Drosophila melanogaster CG11081-PD,
            isoform D protein.
          Length = 1945

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1498 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1557

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1558 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1591



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1593 SQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1652

Query: 436  DSFN 447
              +N
Sbjct: 1653 SIYN 1656



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516  NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
            N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 1693 NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 1731


>AE014135-162|AAF59394.1| 1945|Drosophila melanogaster CG11081-PA,
            isoform A protein.
          Length = 1945

 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1498 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1557

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1558 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1591



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1593 SQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1652

Query: 436  DSFN 447
              +N
Sbjct: 1653 SIYN 1656



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516  NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
            N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 1693 NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 1731


>AF433841-1|AAM17992.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433840-1|AAM17991.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433839-1|AAM17990.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433838-1|AAM17989.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433837-1|AAM17988.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433836-1|AAM17987.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433835-1|AAM17986.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433834-1|AAM17985.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433833-1|AAM17984.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AF433832-1|AAM17983.1|  278|Drosophila melanogaster plexin A
           protein.
          Length = 278

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 516 NSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLT 638
           N+D+ +  + Y+HLVK   +   + K  E  +K + EI+LT
Sbjct: 61  NNDMHENGLRYWHLVK--HHDSDMQKEGERVNKLVSEIYLT 99


>AE014134-2552|AAN10885.1|  187|Drosophila melanogaster CG31832-PA
           protein.
          Length = 187

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 1/81 (1%)
 Frame = +1

Query: 238 LQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHY-GVKESAIM 414
           LQK  +  R   HE+ ++ +HG G  V    +D    +     KL  +  Y G    ++ 
Sbjct: 91  LQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLR 150

Query: 415 SLISRQNDSFNTPYKIPCKNC 477
             I+++  +F+       KNC
Sbjct: 151 YHINKRFSTFDRDNDESSKNC 171


>AE014134-701|AAF51040.2|  387|Drosophila melanogaster CG11767-PA
           protein.
          Length = 387

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = +2

Query: 125 YQTVTLHIVQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGVMV 304
           Y TV L  +QD+  + ++ + ++       +++I+  + K    H+++  +    SGVMV
Sbjct: 205 YFTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMV 264

Query: 305 EVDMLRFKT 331
           E+ +  F T
Sbjct: 265 EITLAHFVT 273


>BT011113-1|AAR82780.1| 1877|Drosophila melanogaster LD22358p protein.
          Length = 1877

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +2

Query: 146  IVQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGV--MVEVDML 319
            IVQ E++E  +  VL    +  V+ ++ D    N P H   LS+ ++  G   +V +D L
Sbjct: 922  IVQVEYNENTRILVLTPLRLGHVRLELTDRCLMNEPSH---LSISVVGIGAIEVVSMDRL 978

Query: 320  RFKTRMSLL 346
               TR+  +
Sbjct: 979  ERTTRIEAI 987


>AY069489-1|AAL39634.1|  973|Drosophila melanogaster LD21888p
           protein.
          Length = 973

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 152 QDEFDEKVQCKVLDC-DSISQVKSKILDALFKNTPFHSDLLSMKLIS 289
           +D+F++++Q   +DC   +  ++    +AL +N   H D LS K ++
Sbjct: 507 EDQFEKELQVSAIDCRKPLIPLEEFYNEALSENIQMHHDYLSYKTLA 553


>AF322889-1|AAG42828.1| 1870|Drosophila melanogaster integral membrane
            pore glycoproteingp210 protein.
          Length = 1870

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +2

Query: 146  IVQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGV--MVEVDML 319
            IVQ E++E  +  VL    +  V+ ++ D    N P H   LS+ ++  G   +V +D L
Sbjct: 915  IVQVEYNENTRILVLTPLRLGHVRLELTDRCLMNEPSH---LSISVVGIGAIEVVSMDRL 971

Query: 320  RFKTRMSLL 346
               TR+  +
Sbjct: 972  ERTTRIEAI 980


>AE014296-1931|AAF50078.1|  973|Drosophila melanogaster CG6190-PA
           protein.
          Length = 973

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 152 QDEFDEKVQCKVLDC-DSISQVKSKILDALFKNTPFHSDLLSMKLIS 289
           +D+F++++Q   +DC   +  ++    +AL +N   H D LS K ++
Sbjct: 507 EDQFEKELQVSAIDCRKPLIPLEEFYNEALSENIQMHHDYLSYKTLA 553


>AE013599-106|AAF57309.2| 1876|Drosophila melanogaster CG7897-PA
            protein.
          Length = 1876

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +2

Query: 146  IVQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGV--MVEVDML 319
            IVQ E++E  +  VL    +  V+ ++ D    N P H   LS+ ++  G   +V +D L
Sbjct: 921  IVQVEYNENTRILVLTPLRLGHVRLELTDRCLMNEPSH---LSISVVGIGAIEVVSMDRL 977

Query: 320  RFKTRMSLL 346
               TR+  +
Sbjct: 978  ERTTRIEAI 986


>AF210453-1|AAF21041.1| 4559|Drosophila melanogaster dynein heavy
           chain protein.
          Length = 4559

 Score = 28.7 bits (61), Expect = 7.7
 Identities = 13/53 (24%), Positives = 28/53 (52%)
 Frame = +2

Query: 23  KAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQC 181
           + +  Q EKG+ D        SL    ++K+ ++     +H++ D+F+E++ C
Sbjct: 512 RMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKHVE---PLMHVIVDDFEEEIMC 561


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,772,105
Number of Sequences: 53049
Number of extensions: 515944
Number of successful extensions: 1281
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 1182
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1276
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2951284050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -