SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20053
         (739 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL121804-3|CAB65855.1|  302|Drosophila melanogaster EG:BACR7C10....    29   6.6  

>AL121804-3|CAB65855.1|  302|Drosophila melanogaster EG:BACR7C10.6
           protein.
          Length = 302

 Score = 29.1 bits (62), Expect = 6.6
 Identities = 21/80 (26%), Positives = 38/80 (47%)
 Frame = -3

Query: 431 SYKQIYFSISQFTSHQARIFFLT**SRDSLIFFSYTLKFYTKILILYSFDEFSMAAFDFA 252
           ++  ++ +IS        + FL    R +L   ++ LKFY+  L+L+   E ++A   F 
Sbjct: 84  NFYDVFLNISLVMILAGTVIFLLLRLRGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFV 143

Query: 251 RTRKTYTSMDKQLIVLHKTI 192
             +   T ++KQ    HK I
Sbjct: 144 CPQYMNTFLEKQF--THKII 161


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,783,500
Number of Sequences: 53049
Number of extensions: 454437
Number of successful extensions: 655
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 636
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 655
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3334818762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -