SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071119-1|AAL48741.1|  133|Drosophila melanogaster RE17056p pro...   106   2e-23
AF320758-1|AAG40877.1|  133|Drosophila melanogaster programmed c...   106   2e-23
AE014296-2662|AAF49524.1|  133|Drosophila melanogaster CG13072-P...   106   2e-23

>AY071119-1|AAL48741.1|  133|Drosophila melanogaster RE17056p
           protein.
          Length = 133

 Score =  106 bits (255), Expect = 2e-23
 Identities = 47/76 (61%), Positives = 63/76 (82%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLNT+K+ +PEKA M ENM+ RMAQMGQ++ K+ +   + ILES N QMP+S+S+
Sbjct: 54  QQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSS 113

Query: 435 VKFDRRRAALDSDDED 482
           VK+DRRRAA+DSDD++
Sbjct: 114 VKYDRRRAAIDSDDDE 129


>AF320758-1|AAG40877.1|  133|Drosophila melanogaster programmed cell
           death gene-5 proteinprotein.
          Length = 133

 Score =  106 bits (255), Expect = 2e-23
 Identities = 47/76 (61%), Positives = 63/76 (82%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLNT+K+ +PEKA M ENM+ RMAQMGQ++ K+ +   + ILES N QMP+S+S+
Sbjct: 54  QQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSS 113

Query: 435 VKFDRRRAALDSDDED 482
           VK+DRRRAA+DSDD++
Sbjct: 114 VKYDRRRAAIDSDDDE 129


>AE014296-2662|AAF49524.1|  133|Drosophila melanogaster CG13072-PA
           protein.
          Length = 133

 Score =  106 bits (255), Expect = 2e-23
 Identities = 47/76 (61%), Positives = 63/76 (82%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLNT+K+ +PEKA M ENM+ RMAQMGQ++ K+ +   + ILES N QMP+S+S+
Sbjct: 54  QQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSS 113

Query: 435 VKFDRRRAALDSDDED 482
           VK+DRRRAA+DSDD++
Sbjct: 114 VKYDRRRAAIDSDDDE 129


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,370,262
Number of Sequences: 53049
Number of extensions: 459336
Number of successful extensions: 1064
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 892
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1064
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2992560750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -