SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...   155   9e-38
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...   155   9e-38
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...   155   9e-38
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...   155   9e-38
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...   155   9e-38
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    66   5e-11
AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p pro...    56   4e-08
BT003756-1|AAO41435.1|  674|Drosophila melanogaster RE71343p pro...    55   1e-07
AY089551-1|AAL90289.1|  975|Drosophila melanogaster LD28793p pro...    55   1e-07
AE014297-4212|AAF56769.1|  975|Drosophila melanogaster CG4849-PA...    55   1e-07
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    49   8e-06
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    48   1e-05
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    48   1e-05
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    48   1e-05
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    48   2e-05
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    42   0.001
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    34   0.19 
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    34   0.19 
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...    33   0.58 
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...    33   0.58 
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...    33   0.58 
BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...    33   0.58 
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...    33   0.58 
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...    33   0.58 
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...    33   0.58 
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...    33   0.58 
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...    33   0.58 
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...    33   0.58 
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...    33   0.58 
BT024277-1|ABC86339.1| 1455|Drosophila melanogaster IP14411p pro...    32   1.0  
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    32   1.0  
AY071090-1|AAL48712.2| 1454|Drosophila melanogaster RE15630p pro...    32   1.0  
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    32   1.0  
AE014297-3788|AAF56460.1| 1266|Drosophila melanogaster CG11902-P...    32   1.0  
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    32   1.0  
AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-P...    31   1.3  
DQ138932-1|ABA86538.1| 1387|Drosophila melanogaster CG12105 prot...    31   1.8  
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    30   4.1  
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    30   4.1  
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    30   4.1  
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...    29   5.4  
BT003527-1|AAO39531.1|  729|Drosophila melanogaster RE22018p pro...    29   5.4  
AY251387-1|AAP51207.1|  729|Drosophila melanogaster tripartite m...    29   5.4  
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...    29   5.4  
AE014134-1916|AAF52977.3|  729|Drosophila melanogaster CG31721-P...    29   5.4  
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...    29   7.2  
DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr...    29   7.2  
DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p...    29   7.2  
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...    29   7.2  
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...    29   7.2  
AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB...    29   7.2  
AY069640-1|AAL39785.1|  396|Drosophila melanogaster LD40702p pro...    29   9.5  
AE014296-2869|AAF49373.2|  396|Drosophila melanogaster CG7853-PA...    29   9.5  
AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE...    29   9.5  
AB242867-1|BAF02844.1|  396|Drosophila melanogaster PAPS transpo...    29   9.5  

>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score =  155 bits (375), Expect = 9e-38
 Identities = 76/107 (71%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKPILFMNKMDR            YQTFQRIVENVNVIIA
Sbjct: 135 CVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIA 194

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY+   ++
Sbjct: 195 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKI 241



 Score =  136 bits (328), Expect = 4e-32
 Identities = 68/85 (80%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAISM+FE+EEKDLVFIT+PDQREK  KGFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVT 126

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 127 DGALVVVDCVSGVCVQTETVLRQAI 151



 Score =  133 bits (322), Expect = 2e-31
 Identities = 63/66 (95%), Positives = 66/66 (100%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVDEIRG+MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AGETRFTDTR
Sbjct: 1   MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score =  155 bits (375), Expect = 9e-38
 Identities = 76/107 (71%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKPILFMNKMDR            YQTFQRIVENVNVIIA
Sbjct: 135 CVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIA 194

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY+   ++
Sbjct: 195 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKI 241



 Score =  136 bits (328), Expect = 4e-32
 Identities = 68/85 (80%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAISM+FE+EEKDLVFIT+PDQREK  KGFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVT 126

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 127 DGALVVVDCVSGVCVQTETVLRQAI 151



 Score =  133 bits (322), Expect = 2e-31
 Identities = 63/66 (95%), Positives = 66/66 (100%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVDEIRG+MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AGETRFTDTR
Sbjct: 1   MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score =  155 bits (375), Expect = 9e-38
 Identities = 76/107 (71%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKPILFMNKMDR            YQTFQRIVENVNVIIA
Sbjct: 123 CVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIA 182

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY+   ++
Sbjct: 183 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKI 229



 Score =  136 bits (328), Expect = 4e-32
 Identities = 68/85 (80%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAISM+FE+EEKDLVFIT+PDQREK  KGFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 55  CITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVT 114

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 115 DGALVVVDCVSGVCVQTETVLRQAI 139



 Score =  110 bits (264), Expect = 2e-24
 Identities = 52/54 (96%), Positives = 54/54 (100%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AGETRFTDTRKDEQ+R
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQER 54


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score =  155 bits (375), Expect = 9e-38
 Identities = 76/107 (71%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKPILFMNKMDR            YQTFQRIVENVNVIIA
Sbjct: 123 CVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIA 182

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY+   ++
Sbjct: 183 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKI 229



 Score =  136 bits (328), Expect = 4e-32
 Identities = 68/85 (80%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAISM+FE+EEKDLVFIT+PDQREK  KGFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 55  CITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVT 114

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 115 DGALVVVDCVSGVCVQTETVLRQAI 139



 Score =  110 bits (264), Expect = 2e-24
 Identities = 52/54 (96%), Positives = 54/54 (100%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AGETRFTDTRKDEQ+R
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQER 54


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score =  155 bits (375), Expect = 9e-38
 Identities = 76/107 (71%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKPILFMNKMDR            YQTFQRIVENVNVIIA
Sbjct: 135 CVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIA 194

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY+   ++
Sbjct: 195 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKI 241



 Score =  136 bits (328), Expect = 4e-32
 Identities = 68/85 (80%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAISM+FE+EEKDLVFIT+PDQREK  KGFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVT 126

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 127 DGALVVVDCVSGVCVQTETVLRQAI 151



 Score =  133 bits (322), Expect = 2e-31
 Identities = 63/66 (95%), Positives = 66/66 (100%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVDEIRG+MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AGETRFTDTR
Sbjct: 1   MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 27/52 (51%), Positives = 40/52 (76%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++ +RN+ ++AHVDHGK+TL DSLV+  GII+   AG+ R+ D R DEQ+R
Sbjct: 15  RRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQER 66



 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 37/82 (45%), Positives = 50/82 (60%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS++IS++++  E+      NPD        +LINLIDSPGHVDFSSEV+ A+R+ D
Sbjct: 68  ITMKSSSISLYYQEAEE---MAGNPD--------YLINLIDSPGHVDFSSEVSTAVRLCD 116

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT   LRQ
Sbjct: 117 GAIVVVDVVEGVGPQTRACLRQ 138



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 19/105 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA-------------TYN 646
           Y E++KP+L +NK+DR            Y    +++E VN ++              T  
Sbjct: 140 YEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILAKEDITKK 199

Query: 647 DDGGPM------GEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           D+           E+   PS G+V F S   GWAF+++ F+ MYA
Sbjct: 200 DNYESALEEVDDSELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYA 244


>AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p
           protein.
          Length = 949

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 27/48 (56%), Positives = 32/48 (66%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           +LINLIDSPGHVDFSSEV+ A+R+ DGA+           QT   LRQ
Sbjct: 7   YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQ 54



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 19/105 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA-------------TYN 646
           Y E++KP+L +NK+DR            Y    +++E VN ++              T  
Sbjct: 56  YEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILAKEDITKK 115

Query: 647 DDGGPM------GEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           D+           E+   PS G+V F S   GWAF+++ F+ MYA
Sbjct: 116 DNYESALEEVDDSELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYA 160


>BT003756-1|AAO41435.1|  674|Drosophila melanogaster RE71343p
           protein.
          Length = 674

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER    + +NK+DR            Y   + IVE VN +++TY   G P   + V P  
Sbjct: 251 ERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY---GAPDDNLLVSPIL 307

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S L+G+ FTLK F+++YA
Sbjct: 308 GNVCFASSLYGFCFTLKSFAKLYA 331



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 21/63 (33%), Positives = 38/63 (60%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSA 518
           ++  +K +L+N+ D+PGHV+FS E TAA+R++DG +            TE +L+ A+   
Sbjct: 193 QDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQER 252

Query: 519 SSL 527
            ++
Sbjct: 253 QAI 255



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKD 243
           + ++ +  +MD    IRN++++ H+ HGK+T  D L+ +           + R+TDT   
Sbjct: 116 YDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFT 175

Query: 244 EQDRASPLNLRP-SLCSSSLKRK 309
           EQ+R   +   P +L    +K+K
Sbjct: 176 EQERGCSIKATPVTLVLQDVKQK 198


>AY089551-1|AAL90289.1|  975|Drosophila melanogaster LD28793p
           protein.
          Length = 975

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER    + +NK+DR            Y   + IVE VN +++TY   G P   + V P  
Sbjct: 251 ERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY---GAPDDNLLVSPIL 307

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S L+G+ FTLK F+++YA
Sbjct: 308 GNVCFASSLYGFCFTLKSFAKLYA 331



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 21/63 (33%), Positives = 38/63 (60%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSA 518
           ++  +K +L+N+ D+PGHV+FS E TAA+R++DG +            TE +L+ A+   
Sbjct: 193 QDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQER 252

Query: 519 SSL 527
            ++
Sbjct: 253 QAI 255



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKD 243
           + ++ +  +MD    IRN++++ H+ HGK+T  D L+ +           + R+TDT   
Sbjct: 116 YDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFT 175

Query: 244 EQDRASPLNLRP-SLCSSSLKRK 309
           EQ+R   +   P +L    +K+K
Sbjct: 176 EQERGCSIKATPVTLVLQDVKQK 198


>AE014297-4212|AAF56769.1|  975|Drosophila melanogaster CG4849-PA
           protein.
          Length = 975

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER    + +NK+DR            Y   + IVE VN +++TY   G P   + V P  
Sbjct: 251 ERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY---GAPDDNLLVSPIL 307

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S L+G+ FTLK F+++YA
Sbjct: 308 GNVCFASSLYGFCFTLKSFAKLYA 331



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 21/63 (33%), Positives = 38/63 (60%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSA 518
           ++  +K +L+N+ D+PGHV+FS E TAA+R++DG +            TE +L+ A+   
Sbjct: 193 QDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQER 252

Query: 519 SSL 527
            ++
Sbjct: 253 QAI 255



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKD 243
           + ++ +  +MD    IRN++++ H+ HGK+T  D L+ +           + R+TDT   
Sbjct: 116 YDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFT 175

Query: 244 EQDRASPLNLRP-SLCSSSLKRK 309
           EQ+R   +   P +L    +K+K
Sbjct: 176 EQERGCSIKATPVTLVLQDVKQK 198


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 112 INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQTLTVNRQ 157



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 42  IRNIGISAHIDSGKTTLTERILFYTGRIA 70


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/48 (50%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN S+IAHVDHGKSTL D L+   G IA    G+ +  D  + E++R
Sbjct: 79  IRNFSIIAHVDHGKSTLADRLLELTGAIA-RNGGQHQVLDNLQVERER 125



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L+NLID+PGHVDFS+EV+ +L   DG +
Sbjct: 145 YLLNLIDTPGHVDFSNEVSRSLAACDGVV 173


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/48 (50%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN S+IAHVDHGKSTL D L+   G IA    G+ +  D  + E++R
Sbjct: 99  IRNFSIIAHVDHGKSTLADRLLELTGAIA-RNGGQHQVLDNLQVERER 145



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L+NLID+PGHVDFS+EV+ +L   DG +
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVV 193


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 24/48 (50%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN S+IAHVDHGKSTL D L+   G IA    G+ +  D  + E++R
Sbjct: 99  IRNFSIIAHVDHGKSTLADRLLELTGAIA-RNGGQHQVLDNLQVERER 145



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L+NLID+PGHVDFS+EV+ +L   DG +
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVV 193


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 24/46 (52%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           +T TV RQ
Sbjct: 112 INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSETLTVNRQ 157



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 42  IRNIGISAHIDSGKTTLTERILFYTGRIA 70


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INL+D+PGH+DF+ EV  +L   DG +           QT TV  QA
Sbjct: 100 INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWSQA 146



 Score = 33.1 bits (72), Expect = 0.44
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAG---IIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  AG    +     G T  TD    E++R
Sbjct: 33  IRNIGILAHIDAGKTTTTERMLFYAGKTRALGEVHRGNT-VTDYLTQERER 82


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++V+ HVDHGK+TL DSL   A + AG   G T+
Sbjct: 165 VTVMGHVDHGKTTLLDSL-RGADVAAGEAGGITQ 197


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++V+ HVDHGK+TL DSL   A + AG   G T+
Sbjct: 165 VTVMGHVDHGKTTLLDSL-RGADVAAGEAGGITQ 197


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.58
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>BT024277-1|ABC86339.1| 1455|Drosophila melanogaster IP14411p
           protein.
          Length = 1455

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 169 SLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLKRK 309
           S+ ++AG+     + ET   DT  +++D  S LN   +LC++ +KRK
Sbjct: 862 SITNEAGLELNLESSET---DTESEQEDNHSSLNYPCNLCTTVVKRK 905


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           N+  I HVDHGK+TLT ++         A + +    D   +E+ R   +N+
Sbjct: 84  NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV 135


>AY071090-1|AAL48712.2| 1454|Drosophila melanogaster RE15630p
           protein.
          Length = 1454

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 169 SLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLKRK 309
           S+ ++AG+     + ET   DT  +++D  S LN   +LC++ +KRK
Sbjct: 861 SITNEAGLELNLESSET---DTESEQEDNHSSLNYPCNLCTTVVKRK 904


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           N+  I HVDHGK+TLT ++         A + +    D   +E+ R   +N+
Sbjct: 84  NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV 135


>AE014297-3788|AAF56460.1| 1266|Drosophila melanogaster CG11902-PA
           protein.
          Length = 1266

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 169 SLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLKRK 309
           S+ ++AG+     + ET   DT  +++D  S LN   +LC++ +KRK
Sbjct: 673 SITNEAGLELNLESSET---DTESEQEDNHSSLNYPCNLCTTVVKRK 716


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           N+  I HVDHGK+TLT ++         A + +    D   +E+ R   +N+
Sbjct: 84  NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV 135


>AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-PA
           protein.
          Length = 881

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTC 389
           +T + CT T  T +TTT   + T + A T+   +TC
Sbjct: 537 TTTTTCTPTTTTTTTTTTTTTTTTTTATTTPTTTTC 572



 Score = 29.9 bits (64), Expect = 4.1
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTC 389
           +T + CT T  T +TTT   + T +   T+   +TC
Sbjct: 455 TTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTC 490



 Score = 29.9 bits (64), Expect = 4.1
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTC 389
           +T + CT T  T +TTT   + T +   T+   +TC
Sbjct: 594 TTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTC 629



 Score = 29.5 bits (63), Expect = 5.4
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKP 356
           +T + CT  P T +TTT AP  T S+  T+   +TC  ++I     P
Sbjct: 720 TTTTTCT--PTTTTTTTCAP--TTSSTTTTSTTTTCTSKTISTTTCP 762



 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTC 389
           +T +  T T  T +TTT AP+ T +   T+   +TC
Sbjct: 700 TTTTTTTTTTTTTTTTTCAPTTTTTCTPTTTTTTTC 735


>DQ138932-1|ABA86538.1| 1387|Drosophila melanogaster CG12105 protein.
          Length = 1387

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = -1

Query: 541  VHEQNRLDALGIA*RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIK 362
            V  + +L  +G     + S CT      STT     + R  A  +EEK T   E + + K
Sbjct: 894  VKRKKKLKLMGDTAAPSTSTCTSPRAASSTTKDCIGIARETASIAEEKETATSEQLAMPK 953


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSL 174
           N+  I HVDHGK+TLT ++
Sbjct: 59  NVGTIGHVDHGKTTLTAAI 77


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSL 174
           N+  I HVDHGK+TLT ++
Sbjct: 59  NVGTIGHVDHGKTTLTAAI 77


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 29.9 bits (64), Expect = 4.1
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSL 174
           N+  I HVDHGK+TLT ++
Sbjct: 59  NVGTIGHVDHGKTTLTAAI 77


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score = 29.5 bits (63), Expect = 5.4
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 97  DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           D+K +I +M VI HVD GKSTL   L+   G ++
Sbjct: 243 DQKSHI-HMIVIGHVDAGKSTLMGHLLYDTGNVS 275


>BT003527-1|AAO39531.1|  729|Drosophila melanogaster RE22018p
           protein.
          Length = 729

 Score = 29.5 bits (63), Expect = 5.4
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 692 GSVGFGSGLHGWAFTLKQFS 751
           GSVGF  G+H W FT+  ++
Sbjct: 594 GSVGFSRGVHYWEFTIDNYT 613


>AY251387-1|AAP51207.1|  729|Drosophila melanogaster tripartite
           motif protein 9 protein.
          Length = 729

 Score = 29.5 bits (63), Expect = 5.4
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 692 GSVGFGSGLHGWAFTLKQFS 751
           GSVGF  G+H W FT+  ++
Sbjct: 594 GSVGFSRGVHYWEFTIDNYT 613


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score = 29.5 bits (63), Expect = 5.4
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 97  DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           D+K +I +M VI HVD GKSTL   L+   G ++
Sbjct: 243 DQKSHI-HMIVIGHVDAGKSTLMGHLLYDTGNVS 275


>AE014134-1916|AAF52977.3|  729|Drosophila melanogaster CG31721-PA
           protein.
          Length = 729

 Score = 29.5 bits (63), Expect = 5.4
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 692 GSVGFGSGLHGWAFTLKQFS 751
           GSVGF  G+H W FT+  ++
Sbjct: 594 GSVGFSRGVHYWEFTIDNYT 613


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           KR   N+  I HVD GKST+   ++S  G++
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMV 222


>DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut
           protein.
          Length = 2176

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 448 TRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLF 344
           T APS+T S  +TS   S+   ES+++   P  +F
Sbjct: 638 TAAPSITISVDITSSGSSSSSSESVEVFTTPAPVF 672


>DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker
           protein.
          Length = 2165

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 448 TRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLF 344
           T APS+T S  +TS   S+   ES+++   P  +F
Sbjct: 627 TAAPSITISVDITSSGSSSSSSESVEVFTTPAPVF 661


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           KR   N+  I HVD GKST+   ++S  G++
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMV 222


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           KR   N+  I HVD GKST+   ++S  G++
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMV 222


>AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB
           protein.
          Length = 1984

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 448 TRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLF 344
           T APS+T S  +TS   S+   ES+++   P  +F
Sbjct: 431 TAAPSITISVDITSSGSSSSSSESVEVFTTPAPVF 465


>AY069640-1|AAL39785.1|  396|Drosophila melanogaster LD40702p
           protein.
          Length = 396

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -1

Query: 445 RAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 320
           R+     +A VT+  K+     S  L  KPF+L   WSG ++
Sbjct: 312 RSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIV 353


>AE014296-2869|AAF49373.2|  396|Drosophila melanogaster CG7853-PA
           protein.
          Length = 396

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -1

Query: 445 RAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 320
           R+     +A VT+  K+     S  L  KPF+L   WSG ++
Sbjct: 312 RSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIV 353


>AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE,
            isoform E protein.
          Length = 9606

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 714  PDPKPTEPLLGSTRTSPMGPPSS 646
            PD +P  PL+ S  TSP   PSS
Sbjct: 2274 PDQRPISPLISSRSTSPAVTPSS 2296


>AB242867-1|BAF02844.1|  396|Drosophila melanogaster PAPS
           transporter protein.
          Length = 396

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -1

Query: 445 RAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 320
           R+     +A VT+  K+     S  L  KPF+L   WSG ++
Sbjct: 312 RSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIV 353


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,964,597
Number of Sequences: 53049
Number of extensions: 813154
Number of successful extensions: 3144
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 2681
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3130
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3623012976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -