SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...   179   3e-45
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...   179   3e-45
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...   179   3e-45
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...   179   3e-45
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...   179   3e-45
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...   178   6e-45
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...   178   6e-45
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...   178   6e-45
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...   176   2e-44
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...   170   2e-42
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...   170   2e-42
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...   104   1e-22
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...   104   1e-22
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   101   1e-21
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   101   1e-21
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   100   2e-21
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...    99   3e-21
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...    99   3e-21
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    73   4e-13
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    73   4e-13
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    73   4e-13
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    68   1e-11
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    68   1e-11
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    68   1e-11
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    36   0.047
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    36   0.063
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    36   0.063
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    35   0.11 
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    35   0.11 
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    35   0.11 
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    35   0.11 
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    35   0.11 
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    35   0.11 
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    34   0.19 
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    34   0.19 
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    34   0.19 
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    34   0.19 
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    34   0.19 
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    33   0.44 
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    33   0.44 
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    33   0.44 
AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p pro...    32   0.77 
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    31   1.0  
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    31   1.0  
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    31   1.0  
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    31   1.8  
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    31   1.8  
BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p pro...    29   4.1  
AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein ...    29   4.1  
AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB...    29   4.1  
M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.    29   7.2  
BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p pro...    29   7.2  
AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB...    29   7.2  
AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA...    29   7.2  

>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score =  179 bits (436), Expect = 3e-45
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score =  179 bits (436), Expect = 3e-45
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score =  179 bits (436), Expect = 3e-45
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score =  179 bits (436), Expect = 3e-45
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score =  179 bits (436), Expect = 3e-45
 Identities = 90/119 (75%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score =  178 bits (433), Expect = 6e-45
 Identities = 89/119 (74%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 157 SSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score =  178 bits (433), Expect = 6e-45
 Identities = 89/119 (74%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 157 SSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score =  178 bits (433), Expect = 6e-45
 Identities = 89/119 (74%), Positives = 98/119 (82%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 157 SSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score =  176 bits (429), Expect = 2e-44
 Identities = 89/119 (74%), Positives = 97/119 (81%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFETSKYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLI AAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIDAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 89.4 bits (212), Expect = 4e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 157 STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score =  170 bits (413), Expect = 2e-42
 Identities = 86/119 (72%), Positives = 95/119 (79%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAV I AAGTGEFEAGISKN QTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 88.6 bits (210), Expect = 6e-18
 Identities = 38/42 (90%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKK+GYNPAAVAFVPISGWHG
Sbjct: 157 SSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPISGWHG 198


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score =  170 bits (413), Expect = 2e-42
 Identities = 86/119 (72%), Positives = 95/119 (79%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYYVTIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAV I AAGTGEFEAGISKN QTREHALLAFTLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQTREHALLAFTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 6e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 88.6 bits (210), Expect = 6e-18
 Identities = 38/42 (90%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKK+GYNPAAVAFVPISGWHG
Sbjct: 157 SSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPISGWHG 198


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score =  104 bits (249), Expect = 1e-22
 Identities = 51/53 (96%), Positives = 51/53 (96%)
 Frame = +1

Query: 358 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 53



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 56  SSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 97


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score =  104 bits (249), Expect = 1e-22
 Identities = 51/53 (96%), Positives = 51/53 (96%)
 Frame = +1

Query: 358 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVG  K
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNK 53



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           S+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPISGWHG
Sbjct: 56  SSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 97


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  101 bits (241), Expect = 1e-21
 Identities = 52/115 (45%), Positives = 72/115 (62%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y RE RE    +    L   L   Q +   ++G T+++    FET + + TI+DAPGH
Sbjct: 228 EKYEREAREKSRESW--YLSWALDTNQEE--RDKGKTVEVGRAFFETDRKHFTILDAPGH 283

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
           + F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+LA T GVK L+V
Sbjct: 284 KSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAMLAKTAGVKHLVV 338



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 29/63 (46%), Positives = 45/63 (71%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 245 KAE 253
           + E
Sbjct: 252 QEE 254



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           + + R+ E K ++  Y+KK+G+NPA  + F+P SG  G
Sbjct: 350 WDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  101 bits (241), Expect = 1e-21
 Identities = 52/115 (45%), Positives = 72/115 (62%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y RE RE    +    L   L   Q +   ++G T+++    FET + + TI+DAPGH
Sbjct: 228 EKYEREAREKSRESW--YLSWALDTNQEE--RDKGKTVEVGRAFFETDRKHFTILDAPGH 283

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
           + F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+LA T GVK L+V
Sbjct: 284 KSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAMLAKTAGVKHLVV 338



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 29/63 (46%), Positives = 45/63 (71%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 245 KAE 253
           + E
Sbjct: 252 QEE 254



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           + + R+ E K ++  Y+KK+G+NPA  + F+P SG  G
Sbjct: 350 WDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  100 bits (239), Expect = 2e-21
 Identities = 50/115 (43%), Positives = 71/115 (61%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y RE RE    +      +  G+   +   ++G T+ +    FET + + TI+DAPGH
Sbjct: 228 EKYEREAREKSRESW----YLSWGLDTNQEERDKGKTVGVGRAFFETDRKHFTILDAPGH 283

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
           + F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+LA T GVK L+V
Sbjct: 284 KSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAMLAKTAGVKHLVV 338



 Score = 65.7 bits (153), Expect = 5e-11
 Identities = 28/63 (44%), Positives = 44/63 (69%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           ++ H+N+V IGHVD+GKST  G ++   G + KRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKYEREAREKSRESWYLSWGLDTN 251

Query: 245 KAE 253
           + E
Sbjct: 252 QEE 254



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           + + R+ E K ++  Y+KK+G+NPA  + F+P SG  G
Sbjct: 350 WDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =   99 bits (238), Expect = 3e-21
 Identities = 46/80 (57%), Positives = 59/80 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G  
Sbjct: 309 RGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFE 368

Query: 439 KNGQTREHALLAFTLGVKQL 498
             GQTREHA+L  +LGV QL
Sbjct: 369 LGGQTREHAILVRSLGVNQL 388



 Score = 81.8 bits (193), Expect = 7e-16
 Identities = 33/63 (52%), Positives = 49/63 (77%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 245 KAE 253
             E
Sbjct: 304 GEE 306


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =   99 bits (238), Expect = 3e-21
 Identities = 46/80 (57%), Positives = 59/80 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G  
Sbjct: 309 RGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFE 368

Query: 439 KNGQTREHALLAFTLGVKQL 498
             GQTREHA+L  +LGV QL
Sbjct: 369 LGGQTREHAILVRSLGVNQL 388



 Score = 81.8 bits (193), Expect = 7e-16
 Identities = 33/63 (52%), Positives = 49/63 (77%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 245 KAE 253
             E
Sbjct: 304 GEE 306


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 38/82 (46%), Positives = 52/82 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G+  ++V
Sbjct: 185 ---QTREHMLLAKQIGIDHIVV 203



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 38/82 (46%), Positives = 52/82 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G+  ++V
Sbjct: 185 ---QTREHMLLAKQIGIDHIVV 203



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 38/82 (46%), Positives = 52/82 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G+  ++V
Sbjct: 185 ---QTREHMLLAKQIGIDHIVV 203



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 37/82 (45%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G++++IV
Sbjct: 160 ---QTREHLLLAKQVGIQRIIV 178



 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 37/82 (45%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G++++IV
Sbjct: 160 ---QTREHLLLAKQVGIQRIIV 178



 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 37/82 (45%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G++++IV
Sbjct: 160 ---QTREHLLLAKQVGIQRIIV 178



 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 35.9 bits (79), Expect = 0.047
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 429
           ERGITI  +   F  + + + ++D PGH DF   +       D  V++V  GT   EA
Sbjct: 81  ERGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVEQSLYAVD-GVVVVLDGTAGVEA 137



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI ++ H+D+GK+TTT  +++  G
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG 58


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 35.5 bits (78), Expect = 0.063
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 423
           +RGITI  A    LWK +T+   + IID PGH DF   +       D AVL++ A  G  
Sbjct: 93  QRGITIQSAATYTLWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQ 148

Query: 424 EAGISKNGQTREH 462
              ++ N Q + +
Sbjct: 149 SETLTVNRQMKRY 161



 Score = 28.3 bits (60), Expect = 9.5
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  +++  G I
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTGRI 69


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 35.5 bits (78), Expect = 0.063
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 423
           +RGITI  A    LWK +T+   + IID PGH DF   +       D AVL++ A  G  
Sbjct: 93  QRGITIQSAATYTLWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQ 148

Query: 424 EAGISKNGQTREH 462
              ++ N Q + +
Sbjct: 149 SQTLTVNRQMKRY 161



 Score = 28.3 bits (60), Expect = 9.5
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  +++  G I
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTGRI 69


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 182 KQILILQNK 190


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 173

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 174 KQILILQNK 182


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 182 KQILILQNK 190


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 182 KQILILQNK 190


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 173

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 174 KQILILQNK 182


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 490 KQLIVGETK 516
           KQ+++ + K
Sbjct: 182 KQILILQNK 190


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 5.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 5.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 29.1 bits (62), Expect = 5.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 86  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 29.1 bits (62), Expect = 5.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 86  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 5.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G+ +D      +  +   T +D PGH   I+ +I G    D  +L+V A  G       K
Sbjct: 52  GLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------K 104

Query: 442 NGQTREHALLAFTLGVKQLIV 504
             QT E  ++   L  K ++V
Sbjct: 105 QTQTAECLIIGELLQKKLIVV 125


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 9/58 (15%)
 Frame = +1

Query: 256 ERGITI---DIALWKFETSK------YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ERGIT+    I+L+  E  +      Y + +ID+PGH DF   + T     D A+++V
Sbjct: 65  ERGITMKSSSISLYYQEAEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 122



 Score = 28.3 bits (60), Expect = 9.5
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 178
           NI ++ HVD GK+T    L+   G I +R   K
Sbjct: 21  NICILAHVDHGKTTLADSLVASNGIISQRMAGK 53


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G+ +D      +  +   T +D PGH   I+ +I G    D  +L+V A  G       K
Sbjct: 52  GLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------K 104

Query: 442 NGQTREHALLAFTLGVKQLIV 504
             QT E  ++   L  K ++V
Sbjct: 105 QTQTAECLIIGELLQKKLIVV 125


>AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p
           protein.
          Length = 949

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 7   YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 38


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIALWK-FETSK---YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+       F   K   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 124 ERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 181


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIALWK-FETSK---YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+       F   K   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 144 ERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIALWK-FETSK---YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+       F   K   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 144 ERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           VT +D PGH  F      G    D  VL+VAA  G
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           VT +D PGH  F      G    D  VL+VAA  G
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.
          Length = 993

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 506 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 408
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


>BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p
           protein.
          Length = 683

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 506 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 408
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 93  PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 125


>AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB,
           isoform B protein.
          Length = 885

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 506 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 408
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 295 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 327


>AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA,
           isoform A protein.
          Length = 954

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 506 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 408
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,602,231
Number of Sequences: 53049
Number of extensions: 613091
Number of successful extensions: 2107
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 1978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2101
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -