SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT004874-1|AAO45230.1|  453|Drosophila melanogaster LD23573p pro...   107   1e-23
AE013599-1745|AAF58356.1|  453|Drosophila melanogaster CG33156-P...   107   1e-23
BT001677-1|AAN71432.1|  490|Drosophila melanogaster RE54276p pro...   105   4e-23
BT001490-1|AAN71245.1|  454|Drosophila melanogaster LD26002p pro...   105   4e-23
AE013599-1744|AAM68591.2|  490|Drosophila melanogaster CG33156-P...   105   4e-23
AE013599-1743|AAF58355.1|  454|Drosophila melanogaster CG33156-P...   105   4e-23
BT014633-1|AAT27257.1|  548|Drosophila melanogaster RH58004p pro...   102   4e-22
AE013599-1741|AAM68589.1|  548|Drosophila melanogaster CG6145-PC...   102   4e-22
AE013599-1740|AAF58358.1|  520|Drosophila melanogaster CG6145-PA...   102   4e-22
BT001874-1|AAN71646.1|  375|Drosophila melanogaster SD09038p pro...    63   4e-10
AY069729-1|AAL39874.1|  420|Drosophila melanogaster LP03268p pro...    63   4e-10
AE013599-1746|AAF58357.1|  375|Drosophila melanogaster CG33156-P...    63   4e-10
AE013599-1742|AAM68590.1|  420|Drosophila melanogaster CG6145-PB...    63   4e-10
AY069170-1|AAL39315.1|  386|Drosophila melanogaster GH20987p pro...    28   9.4  
AJ224690-1|CAA12074.1|  386|Drosophila melanogaster C-terminal b...    28   9.4  
AE014297-1618|AAN14340.1|  386|Drosophila melanogaster CG7583-PD...    28   9.4  
AE014297-1617|AAN14339.1|  386|Drosophila melanogaster CG7583-PC...    28   9.4  
AE014297-1616|AAF54892.1|  386|Drosophila melanogaster CG7583-PB...    28   9.4  
AE014297-1615|AAF54891.1|  386|Drosophila melanogaster CG7583-PA...    28   9.4  
AE014297-1614|AAX52947.1|  476|Drosophila melanogaster CG7583-PE...    28   9.4  
AB011840-1|BAA25287.1|  383|Drosophila melanogaster CtBP protein.      28   9.4  

>BT004874-1|AAO45230.1|  453|Drosophila melanogaster LD23573p
           protein.
          Length = 453

 Score =  107 bits (258), Expect = 1e-23
 Identities = 48/49 (97%), Positives = 49/49 (100%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 58  RRTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 106



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 107 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 149


>AE013599-1745|AAF58356.1|  453|Drosophila melanogaster CG33156-PB,
           isoform B protein.
          Length = 453

 Score =  107 bits (258), Expect = 1e-23
 Identities = 48/49 (97%), Positives = 49/49 (100%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 58  RRTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 106



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 107 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 149


>BT001677-1|AAN71432.1|  490|Drosophila melanogaster RE54276p
           protein.
          Length = 490

 Score =  105 bits (253), Expect = 4e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 143



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 27/43 (62%), Positives = 34/43 (79%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+   L E
Sbjct: 144 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEGVQLNE 186


>BT001490-1|AAN71245.1|  454|Drosophila melanogaster LD26002p
           protein.
          Length = 454

 Score =  105 bits (253), Expect = 4e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 60  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 107



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 108 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 150


>AE013599-1744|AAM68591.2|  490|Drosophila melanogaster CG33156-PE,
           isoform E protein.
          Length = 490

 Score =  105 bits (253), Expect = 4e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 143



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 144 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 186


>AE013599-1743|AAF58355.1|  454|Drosophila melanogaster CG33156-PA,
           isoform A protein.
          Length = 454

 Score =  105 bits (253), Expect = 4e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 60  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 107



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 108 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 150


>BT014633-1|AAT27257.1|  548|Drosophila melanogaster RH58004p
           protein.
          Length = 548

 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/48 (95%), Positives = 46/48 (95%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP Q FGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 157 VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 198


>AE013599-1741|AAM68589.1|  548|Drosophila melanogaster CG6145-PC,
           isoform C protein.
          Length = 548

 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/48 (95%), Positives = 46/48 (95%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP Q FGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 157 VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 198


>AE013599-1740|AAF58358.1|  520|Drosophila melanogaster CG6145-PA,
           isoform A protein.
          Length = 520

 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/48 (95%), Positives = 46/48 (95%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP Q FGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 81  RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 128



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 129 VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 170


>BT001874-1|AAN71646.1|  375|Drosophila melanogaster SD09038p
           protein.
          Length = 375

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 426 MKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           MKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPPLTVL 28



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 29  VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 71


>AY069729-1|AAL39874.1|  420|Drosophila melanogaster LP03268p
           protein.
          Length = 420

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 426 MKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           MKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPPLTVL 28



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 29  VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 70


>AE013599-1746|AAF58357.1|  375|Drosophila melanogaster CG33156-PC,
           isoform C protein.
          Length = 375

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 426 MKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           MKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPPLTVL 28



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+D  L E
Sbjct: 29  VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDVQLNE 71


>AE013599-1742|AAM68590.1|  420|Drosophila melanogaster CG6145-PB,
           isoform B protein.
          Length = 420

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 426 MKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           MKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPPLTVL 28



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 29  VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 70


>AY069170-1|AAL39315.1|  386|Drosophila melanogaster GH20987p
           protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AJ224690-1|CAA12074.1|  386|Drosophila melanogaster C-terminal
           binding protein protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AE014297-1618|AAN14340.1|  386|Drosophila melanogaster CG7583-PD,
           isoform D protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AE014297-1617|AAN14339.1|  386|Drosophila melanogaster CG7583-PC,
           isoform C protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AE014297-1616|AAF54892.1|  386|Drosophila melanogaster CG7583-PB,
           isoform B protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AE014297-1615|AAF54891.1|  386|Drosophila melanogaster CG7583-PA,
           isoform A protein.
          Length = 386

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AE014297-1614|AAX52947.1|  476|Drosophila melanogaster CG7583-PE,
           isoform E protein.
          Length = 476

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


>AB011840-1|BAA25287.1|  383|Drosophila melanogaster CtBP protein.
          Length = 383

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 640 LLRKECVIQNCRLDEHHHAFVMNEPVY*LNEGCQYLGVV--NLLDDSTVRGGLYQ 482
           L + +CV  +C L+EH+H  +    +  +  G   +      L+DD T+   L Q
Sbjct: 227 LFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQ 281


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,170,694
Number of Sequences: 53049
Number of extensions: 723795
Number of successful extensions: 1927
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1834
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1927
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2724262200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -