SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT016051-1|AAV36936.1| 1132|Drosophila melanogaster LP17541p pro...    74   3e-13
AE014298-797|AAF46083.2| 1132|Drosophila melanogaster CG3108-PA ...    74   3e-13
AY071562-1|AAL49184.1|  416|Drosophila melanogaster RE62864p pro...    34   0.25 
AE014296-1161|AAF50637.2|  416|Drosophila melanogaster CG14820-P...    34   0.25 
AE014298-795|AAF46081.1|  507|Drosophila melanogaster CG15769-PA...    33   0.33 
AY071750-1|AAL49372.1|  422|Drosophila melanogaster RH58587p pro...    32   0.76 
AY070608-1|AAL48079.1|  430|Drosophila melanogaster RE71127p pro...    32   0.76 
AE014134-1692|AAF52810.1|  430|Drosophila melanogaster CG17633-P...    32   0.76 
AE013599-1585|AAF58456.1|  422|Drosophila melanogaster CG12374-P...    32   0.76 
AF145671-1|AAD38646.1|  800|Drosophila melanogaster BcDNA.GH1197...    30   3.1  
AE014296-3529|AAF51717.1|  800|Drosophila melanogaster CG6014-PA...    30   3.1  
U76378-1|AAB18789.1| 1150|Drosophila melanogaster LK6 protein ki...    30   4.0  
BT011072-1|AAR82737.1|  422|Drosophila melanogaster SD22574p pro...    30   4.0  
AL021726-1|CAA16809.1| 1002|Drosophila melanogaster EG:171E4.1,F...    30   4.0  
AE014297-1373|AAF54695.1| 1090|Drosophila melanogaster CG17342-P...    30   4.0  
AE014297-1372|AAF54694.1| 1142|Drosophila melanogaster CG17342-P...    30   4.0  
X86683-1|CAA60382.1| 1002|Drosophila melanogaster deep orange (d...    29   5.3  
BT022761-1|AAY55177.1|  317|Drosophila melanogaster IP12334p pro...    29   5.3  
AY061592-1|AAL29140.1| 1002|Drosophila melanogaster SD04291p pro...    29   5.3  
AE014298-240|AAF45652.1| 1002|Drosophila melanogaster CG3093-PA ...    29   5.3  
AE014134-3071|AAF53786.1|  317|Drosophila melanogaster CG17350-P...    29   5.3  
AY113471-1|AAM29476.1|  445|Drosophila melanogaster RE43153p pro...    29   7.1  
AE014298-794|AAF46080.2|  445|Drosophila melanogaster CG3097-PA ...    29   7.1  
L26082-1|AAA88789.1|  771|Drosophila melanogaster semaphorin-I p...    29   9.3  
AE014134-1544|AAF52696.2|  899|Drosophila melanogaster CG18405-P...    29   9.3  
AE014134-1543|AAN10677.2| 1019|Drosophila melanogaster CG18405-P...    29   9.3  

>BT016051-1|AAV36936.1| 1132|Drosophila melanogaster LP17541p
           protein.
          Length = 1132

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/52 (59%), Positives = 44/52 (84%)
 Frame = +2

Query: 533 VVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           V+I++LQ+ I +ENPP +    ELQ+R+GHR+TW+ YHRLEDI+GF+DY+AK
Sbjct: 786 VLIDNLQRVIEKENPPAEKIA-ELQNRKGHRLTWQAYHRLEDIHGFIDYMAK 836



 Score = 30.3 bits (65), Expect = 3.1
 Identities = 14/56 (25%), Positives = 27/56 (48%)
 Frame = +3

Query: 345 YSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNVVENITRVLK 512
           Y G+QVW++       +++   L+ +     W   +  VD L+KP V+    R ++
Sbjct: 723 YDGAQVWRIVVQTDKDKRMADELQSKYDGQLWKEVKQEVDYLLKPQVLAAAERHIR 778


>AE014298-797|AAF46083.2| 1132|Drosophila melanogaster CG3108-PA
           protein.
          Length = 1132

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/52 (59%), Positives = 44/52 (84%)
 Frame = +2

Query: 533 VVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           V+I++LQ+ I +ENPP +    ELQ+R+GHR+TW+ YHRLEDI+GF+DY+AK
Sbjct: 786 VLIDNLQRVIEKENPPAEKIA-ELQNRKGHRLTWQAYHRLEDIHGFIDYMAK 836



 Score = 30.3 bits (65), Expect = 3.1
 Identities = 14/56 (25%), Positives = 27/56 (48%)
 Frame = +3

Query: 345 YSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNVVENITRVLK 512
           Y G+QVW++       +++   L+ +     W   +  VD L+KP V+    R ++
Sbjct: 723 YDGAQVWRIVVQTDKDKRMADELQSKYDGQLWKEVKQEVDYLLKPQVLAAAERHIR 778


>AY071562-1|AAL49184.1|  416|Drosophila melanogaster RE62864p
           protein.
          Length = 416

 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/68 (25%), Positives = 35/68 (51%)
 Frame = +2

Query: 479 ECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLED 658
           E ++ + +   + +  YN+ I+++Q  I+ + P           +R   M W Q+H LE+
Sbjct: 71  EYQKTFESLLTKHNFTYNLKIDNVQTHIDAQRPK----------QRITSMEWTQFHTLEE 120

Query: 659 IYGFMDYL 682
           IY ++D +
Sbjct: 121 IYAWLDVI 128


>AE014296-1161|AAF50637.2|  416|Drosophila melanogaster CG14820-PA
           protein.
          Length = 416

 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/68 (25%), Positives = 35/68 (51%)
 Frame = +2

Query: 479 ECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLED 658
           E ++ + +   + +  YN+ I+++Q  I+ + P           +R   M W Q+H LE+
Sbjct: 71  EYQKTFESLLTKHNFTYNLKIDNVQTHIDAQRPK----------QRITSMEWTQFHTLEE 120

Query: 659 IYGFMDYL 682
           IY ++D +
Sbjct: 121 IYAWLDVI 128


>AE014298-795|AAF46081.1|  507|Drosophila melanogaster CG15769-PA
           protein.
          Length = 507

 Score = 33.5 bits (73), Expect = 0.33
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 10/62 (16%)
 Frame = +2

Query: 527 YNVVIEDLQKRINE---ENP----PLD---NDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           YN++I+D++  I+E   E P    PLD   N+ +   +  G  M W++YH   DI  F+ 
Sbjct: 153 YNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQ 212

Query: 677 YL 682
            L
Sbjct: 213 TL 214


>AY071750-1|AAL49372.1|  422|Drosophila melanogaster RH58587p
           protein.
          Length = 422

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           I Y V+++DLQK I+E +   D+           +M W+ YH L+ IY ++D
Sbjct: 89  IVYEVIVDDLQKLIDESSVGDDS-----------QMEWETYHTLDTIYDWID 129


>AY070608-1|AAL48079.1|  430|Drosophila melanogaster RE71127p
           protein.
          Length = 430

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 16/59 (27%), Positives = 32/59 (54%)
 Frame = +2

Query: 512 RESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           +  I Y +   D+QK ++E    +D +++ ++ R      W QY+ L+D Y ++  LA+
Sbjct: 87  KSEIKYELQSRDVQKSLDE----ID-EKVAIKGRATTAYNWAQYYELDDTYAWLQSLAQ 140


>AE014134-1692|AAF52810.1|  430|Drosophila melanogaster CG17633-PA
           protein.
          Length = 430

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 16/59 (27%), Positives = 32/59 (54%)
 Frame = +2

Query: 512 RESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           +  I Y +   D+QK ++E    +D +++ ++ R      W QY+ L+D Y ++  LA+
Sbjct: 87  KSEIKYELQSRDVQKSLDE----ID-EKVAIKGRATTAYNWAQYYELDDTYAWLQSLAQ 140


>AE013599-1585|AAF58456.1|  422|Drosophila melanogaster CG12374-PA
           protein.
          Length = 422

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           I Y V+++DLQK I+E +   D+           +M W+ YH L+ IY ++D
Sbjct: 89  IVYEVIVDDLQKLIDESSVGDDS-----------QMEWETYHTLDTIYDWID 129


>AF145671-1|AAD38646.1|  800|Drosophila melanogaster BcDNA.GH11973
           protein.
          Length = 800

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIY 664
           E I     +E  Q+R  EE      +E E QDR+ H     +  RL D+Y
Sbjct: 521 ERIQKQRELEAQQRREREEQRRKQREEQEEQDRQNHAKRLAEEKRLHDLY 570


>AE014296-3529|AAF51717.1|  800|Drosophila melanogaster CG6014-PA
           protein.
          Length = 800

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIY 664
           E I     +E  Q+R  EE      +E E QDR+ H     +  RL D+Y
Sbjct: 521 ERIQKQRELEAQQRREREEQRRKQREEQEEQDRQNHAKRLAEEKRLHDLY 570


>U76378-1|AAB18789.1| 1150|Drosophila melanogaster LK6 protein
           kinase protein.
          Length = 1150

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 470 YQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHR 649
           YQ +C       F+R+S      +ED +   NE+     +   EL +  G    ++Q  R
Sbjct: 578 YQQQCETLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDYLYEQQQR 637

Query: 650 LEDIYGFMDYLAKP 691
           ++D +G  ++  +P
Sbjct: 638 VDDKFGEEEFEDEP 651


>BT011072-1|AAR82737.1|  422|Drosophila melanogaster SD22574p
           protein.
          Length = 422

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 470 YQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHR 649
           YQ +C       F+R+S      +ED +   NE+     +   EL +  G    ++Q  R
Sbjct: 287 YQQQCETLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDYLYEQQQR 346

Query: 650 LEDIYGFMDYLAKP 691
           ++D +G  ++  +P
Sbjct: 347 VDDKFGEEEFEDEP 360


>AL021726-1|CAA16809.1| 1002|Drosophila melanogaster
           EG:171E4.1,FBgn0000482;dor protein.
          Length = 1002

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 524 DYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT 631
           DYN  I++LQ+ + E     D    ELQ  R H +T
Sbjct: 843 DYNQRIQELQREMAETTEQTDRATAELQQLRQHSLT 878


>AE014297-1373|AAF54695.1| 1090|Drosophila melanogaster CG17342-PB,
           isoform B protein.
          Length = 1090

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 470 YQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHR 649
           YQ +C       F+R+S      +ED +   NE+     +   EL +  G    ++Q  R
Sbjct: 526 YQQQCETLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDYLYEQQQR 585

Query: 650 LEDIYGFMDYLAKP 691
           ++D +G  ++  +P
Sbjct: 586 VDDKFGEEEFEDEP 599


>AE014297-1372|AAF54694.1| 1142|Drosophila melanogaster CG17342-PA,
           isoform A protein.
          Length = 1142

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 470 YQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHR 649
           YQ +C       F+R+S      +ED +   NE+     +   EL +  G    ++Q  R
Sbjct: 578 YQQQCETLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDYLYEQQQR 637

Query: 650 LEDIYGFMDYLAKP 691
           ++D +G  ++  +P
Sbjct: 638 VDDKFGEEEFEDEP 651


>X86683-1|CAA60382.1| 1002|Drosophila melanogaster deep orange (dor)
           protein.
          Length = 1002

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 524 DYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT 631
           DYN  I++LQ+ + E     D    ELQ  R H +T
Sbjct: 843 DYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLT 878


>BT022761-1|AAY55177.1|  317|Drosophila melanogaster IP12334p
           protein.
          Length = 317

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 5/45 (11%)
 Frame = +3

Query: 15  RGGGSSK-----PPEPALQSKPNFTFSSHGIQEANGRVVLGGPNR 134
           RGG  SK     P +P  Q  PNF+   HG Q AN R    G NR
Sbjct: 170 RGGSESKHKTRKPYDPKSQWNPNFSGEQHGYQGAN-RGGYQGSNR 213


>AY061592-1|AAL29140.1| 1002|Drosophila melanogaster SD04291p
           protein.
          Length = 1002

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 524 DYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT 631
           DYN  I++LQ+ + E     D    ELQ  R H +T
Sbjct: 843 DYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLT 878


>AE014298-240|AAF45652.1| 1002|Drosophila melanogaster CG3093-PA
           protein.
          Length = 1002

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 524 DYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT 631
           DYN  I++LQ+ + E     D    ELQ  R H +T
Sbjct: 843 DYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLT 878


>AE014134-3071|AAF53786.1|  317|Drosophila melanogaster CG17350-PA
           protein.
          Length = 317

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 5/45 (11%)
 Frame = +3

Query: 15  RGGGSSK-----PPEPALQSKPNFTFSSHGIQEANGRVVLGGPNR 134
           RGG  SK     P +P  Q  PNF+   HG Q AN R    G NR
Sbjct: 170 RGGSESKHKTRKPYDPKSQWNPNFSGEQHGYQGAN-RGGYQGSNR 213


>AY113471-1|AAM29476.1|  445|Drosophila melanogaster RE43153p
           protein.
          Length = 445

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 11/16 (68%), Positives = 11/16 (68%)
 Frame = +2

Query: 626 MTWKQYHRLEDIYGFM 673
           M WK YH LE IY FM
Sbjct: 143 MHWKDYHDLETIYSFM 158


>AE014298-794|AAF46080.2|  445|Drosophila melanogaster CG3097-PA
           protein.
          Length = 445

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 11/16 (68%), Positives = 11/16 (68%)
 Frame = +2

Query: 626 MTWKQYHRLEDIYGFM 673
           M WK YH LE IY FM
Sbjct: 143 MHWKDYHDLETIYSFM 158


>L26082-1|AAA88789.1|  771|Drosophila melanogaster semaphorin-I
           protein.
          Length = 771

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = -2

Query: 188 CGHSS--PGCSSLIRGELRTTVRAAKNNTTVCLLDPMATERKVRF*LQSWFGGLRRTAAS 15
           CG +S  P C++ I  +   T+ A KN   VC  DP      V    + + G +   + S
Sbjct: 120 CGTNSFRPMCNTYIISDSNYTLEATKNGQAVCPYDPRHNSTSVLADNELYSGTVADFSGS 179

Query: 14  QP 9
            P
Sbjct: 180 DP 181


>AE014134-1544|AAF52696.2|  899|Drosophila melanogaster CG18405-PA,
           isoform A protein.
          Length = 899

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = -2

Query: 188 CGHSS--PGCSSLIRGELRTTVRAAKNNTTVCLLDPMATERKVRF*LQSWFGGLRRTAAS 15
           CG +S  P C++ I  +   T+ A KN   VC  DP      V    + + G +   + S
Sbjct: 169 CGTNSFRPMCNTYIISDSNYTLEATKNGQAVCPYDPRHNSTSVLADNELYSGTVADFSGS 228

Query: 14  QP 9
            P
Sbjct: 229 DP 230


>AE014134-1543|AAN10677.2| 1019|Drosophila melanogaster CG18405-PB,
           isoform B protein.
          Length = 1019

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = -2

Query: 188 CGHSS--PGCSSLIRGELRTTVRAAKNNTTVCLLDPMATERKVRF*LQSWFGGLRRTAAS 15
           CG +S  P C++ I  +   T+ A KN   VC  DP      V    + + G +   + S
Sbjct: 169 CGTNSFRPMCNTYIISDSNYTLEATKNGQAVCPYDPRHNSTSVLADNELYSGTVADFSGS 228

Query: 14  QP 9
            P
Sbjct: 229 DP 230


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,916,469
Number of Sequences: 53049
Number of extensions: 652493
Number of successful extensions: 1946
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 1865
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1943
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3561257073
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -