SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-1775|AAF48170.1|  470|Drosophila melanogaster CG2556-PA...    30   2.4  
EF428975-1|ABO20847.1| 2381|Drosophila melanogaster Kon-tiki pro...    29   4.2  
AY051797-1|AAK93221.1|  514|Drosophila melanogaster LD31354p pro...    29   4.2  
AE014134-2938|AAF53672.2| 2355|Drosophila melanogaster CG10275-P...    29   4.2  
DQ231600-1|ABA71706.1|  500|Drosophila melanogaster male accesso...    29   7.4  
AY052024-1|AAK93448.1|  557|Drosophila melanogaster LD47616p pro...    29   7.4  
AE014297-454|AAF54127.2|  500|Drosophila melanogaster CG10284-PA...    29   7.4  
AE014296-589|AAF47733.2|  557|Drosophila melanogaster CG14965-PA...    29   7.4  
BT024296-1|ABC86358.1|  400|Drosophila melanogaster IP12474p pro...    28   9.8  
AE014297-696|AAF54190.2|  476|Drosophila melanogaster CG7900-PA ...    28   9.8  

>AE014298-1775|AAF48170.1|  470|Drosophila melanogaster CG2556-PA
           protein.
          Length = 470

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +1

Query: 196 KEDPLSRIQREIIEVTERERNLKKVTSEST 285
           K DPL+RIQ EI EV  RE   +++ + S+
Sbjct: 8   KIDPLTRIQEEIKEVVRREEEYRQLATLSS 37


>EF428975-1|ABO20847.1| 2381|Drosophila melanogaster Kon-tiki protein.
          Length = 2381

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 105  NSETFVCNYQLPSHSDIGLRYEFHH 179
            N E F+   Q P+H +IGL +EF H
Sbjct: 1752 NPELFIEAIQKPTHGNIGLGHEFKH 1776


>AY051797-1|AAK93221.1|  514|Drosophila melanogaster LD31354p
           protein.
          Length = 514

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 105 NSETFVCNYQLPSHSDIGLRYEFHH 179
           N E F+   Q P+H +IGL +EF H
Sbjct: 192 NPELFIEAIQKPTHGNIGLGHEFKH 216


>AE014134-2938|AAF53672.2| 2355|Drosophila melanogaster CG10275-PA
            protein.
          Length = 2355

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 105  NSETFVCNYQLPSHSDIGLRYEFHH 179
            N E F+   Q P+H +IGL +EF H
Sbjct: 1726 NPELFIEAIQKPTHGNIGLGHEFKH 1750


>DQ231600-1|ABA71706.1|  500|Drosophila melanogaster male accessory
           gland protein protein.
          Length = 500

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +1

Query: 508 YSQQRKAAPAFKCGLNTEYGH---RPSPYFPLDSSIGTSSFPPIITRT 642
           Y   +KAA + K G N +Y H       Y  +    G +S P I TRT
Sbjct: 255 YEPGKKAAESCKTGANPKYAHLCAESEVYEKVTPKAGNASSPEIKTRT 302


>AY052024-1|AAK93448.1|  557|Drosophila melanogaster LD47616p
           protein.
          Length = 557

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = +1

Query: 184 DSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCPNLRSTLIIRMDT*TAMLMRKYH 363
           D LL+E    ++Q E  +++E    LK++ +ES      ++ T +        M ++KY 
Sbjct: 425 DKLLQE--YDKLQAEFEKLSEENAKLKRLQAESPWTSAAIKPTALSLSKPQLYMAIKKYV 482

Query: 364 GPS 372
           GP+
Sbjct: 483 GPT 485


>AE014297-454|AAF54127.2|  500|Drosophila melanogaster CG10284-PA
           protein.
          Length = 500

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +1

Query: 508 YSQQRKAAPAFKCGLNTEYGH---RPSPYFPLDSSIGTSSFPPIITRT 642
           Y   +KAA + K G N +Y H       Y  +    G +S P I TRT
Sbjct: 255 YEPGKKAAESCKTGANPKYAHLCAESEVYEKVTPKAGNASSPEIKTRT 302


>AE014296-589|AAF47733.2|  557|Drosophila melanogaster CG14965-PA
           protein.
          Length = 557

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = +1

Query: 184 DSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCPNLRSTLIIRMDT*TAMLMRKYH 363
           D LL+E    ++Q E  +++E    LK++ +ES      ++ T +        M ++KY 
Sbjct: 425 DKLLQE--YDKLQAEFEKLSEENAKLKRLQAESPWTSAAIKPTALSLSKPQLYMAIKKYV 482

Query: 364 GPS 372
           GP+
Sbjct: 483 GPT 485


>BT024296-1|ABC86358.1|  400|Drosophila melanogaster IP12474p
           protein.
          Length = 400

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = -3

Query: 630 DRRETTGANTGVEGKIRGGAMAVFGVEAAFEGGGSFP 520
           D   T+G ++G EG + G   ++FG+ +   G    P
Sbjct: 60  DSERTSGGSSGGEGSLNGAGASLFGIGSDIGGSIRIP 96


>AE014297-696|AAF54190.2|  476|Drosophila melanogaster CG7900-PA
           protein.
          Length = 476

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = -3

Query: 630 DRRETTGANTGVEGKIRGGAMAVFGVEAAFEGGGSFP 520
           D   T+G ++G EG + G   ++FG+ +   G    P
Sbjct: 136 DSERTSGGSSGGEGSLNGAGASLFGIGSDIGGSIRIP 172


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,035,852
Number of Sequences: 53049
Number of extensions: 604075
Number of successful extensions: 2468
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2466
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -