SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT016131-1|AAV37016.1|  812|Drosophila melanogaster GH14147p pro...    96   4e-20
BT001540-1|AAN71295.1|  846|Drosophila melanogaster RE09889p pro...    96   4e-20
AY050572-1|AAL11434.1|  803|Drosophila melanogaster tyrosine tra...    96   4e-20
AY050571-1|AAL11433.1|  812|Drosophila melanogaster tyrosine tra...    96   4e-20
AF145605-1|AAD38580.1|  803|Drosophila melanogaster BcDNA.GH0263...    96   4e-20
AE014134-805|AAF50961.1|  803|Drosophila melanogaster CG12787-PA...    96   4e-20
AE014134-804|AAO41156.1|  812|Drosophila melanogaster CG12787-PF...    96   4e-20
AE014134-803|AAO41155.1|  812|Drosophila melanogaster CG12787-PE...    96   4e-20
AE014134-802|AAO41154.1|  812|Drosophila melanogaster CG12787-PD...    96   4e-20
AE014134-801|AAF50960.3|  812|Drosophila melanogaster CG12787-PB...    96   4e-20
AE014134-800|AAF50959.2|  846|Drosophila melanogaster CG12787-PC...    96   4e-20
BT023125-1|AAY55541.1|  534|Drosophila melanogaster IP03617p pro...    74   2e-13
BT023088-1|AAY55504.1|  882|Drosophila melanogaster IP03817p pro...    74   2e-13
BT023069-1|AAY55485.1|  882|Drosophila melanogaster IP03917p pro...    74   2e-13
AY050573-1|AAL11435.1|  712|Drosophila melanogaster tyrosine tra...    74   2e-13
AE014134-807|AAF50958.1|  846|Drosophila melanogaster CG15624-PA...    74   2e-13
AE014134-806|AAX52648.1|  820|Drosophila melanogaster CG15624-PB...    74   2e-13
AE014296-2224|AAF49861.2|  702|Drosophila melanogaster CG11262-P...    73   3e-13
AY069194-1|AAL39339.1|  634|Drosophila melanogaster GH25177p pro...    62   6e-10
AE014134-3556|ABC65925.1|  607|Drosophila melanogaster CG31693-P...    62   6e-10
AE014134-3555|AAN11139.2|  688|Drosophila melanogaster CG31693-P...    62   6e-10
BT025092-1|ABE73263.1|  690|Drosophila melanogaster IP12954p pro...    62   7e-10
AE014296-442|AAF47636.1|  690|Drosophila melanogaster CG13801-PA...    62   7e-10

>BT016131-1|AAV37016.1|  812|Drosophila melanogaster GH14147p
           protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>BT001540-1|AAN71295.1|  846|Drosophila melanogaster RE09889p
           protein.
          Length = 846

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 794 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 846


>AY050572-1|AAL11434.1|  803|Drosophila melanogaster tyrosine
           transporter hoepel1 variantA protein.
          Length = 803

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 751 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 803


>AY050571-1|AAL11433.1|  812|Drosophila melanogaster tyrosine
           transporter hoepel1 variantB protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>AF145605-1|AAD38580.1|  803|Drosophila melanogaster BcDNA.GH02636
           protein.
          Length = 803

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 751 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 803


>AE014134-805|AAF50961.1|  803|Drosophila melanogaster CG12787-PA,
           isoform A protein.
          Length = 803

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 751 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 803


>AE014134-804|AAO41156.1|  812|Drosophila melanogaster CG12787-PF,
           isoform F protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>AE014134-803|AAO41155.1|  812|Drosophila melanogaster CG12787-PE,
           isoform E protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>AE014134-802|AAO41154.1|  812|Drosophila melanogaster CG12787-PD,
           isoform D protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>AE014134-801|AAF50960.3|  812|Drosophila melanogaster CG12787-PB,
           isoform B protein.
          Length = 812

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 760 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812


>AE014134-800|AAF50959.2|  846|Drosophila melanogaster CG12787-PC,
           isoform C protein.
          Length = 846

 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAGVAEQHGYKFTF+ FFK+GFPIMIG ++V + YL++ H +FAWH
Sbjct: 794 GASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 846


>BT023125-1|AAY55541.1|  534|Drosophila melanogaster IP03617p
           protein.
          Length = 534

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 482 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 534


>BT023088-1|AAY55504.1|  882|Drosophila melanogaster IP03817p
           protein.
          Length = 882

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 830 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 882


>BT023069-1|AAY55485.1|  882|Drosophila melanogaster IP03917p
           protein.
          Length = 882

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 830 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 882


>AY050573-1|AAL11435.1|  712|Drosophila melanogaster tyrosine
           transporter hoepel2 protein.
          Length = 712

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 660 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 712


>AE014134-807|AAF50958.1|  846|Drosophila melanogaster CG15624-PA,
           isoform A protein.
          Length = 846

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 794 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 846


>AE014134-806|AAX52648.1|  820|Drosophila melanogaster CG15624-PB,
           isoform B protein.
          Length = 820

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANV+ AG+AEQHGYK +F  + +  FP+M+G + + ++YL++ H VF WH
Sbjct: 768 GASANVIAAGIAEQHGYKLSFTRYLRTVFPMMLGQITLMTVYLLVAHVVFEWH 820


>AE014296-2224|AAF49861.2|  702|Drosophila melanogaster CG11262-PA
           protein.
          Length = 702

 Score = 73.3 bits (172), Expect = 3e-13
 Identities = 29/53 (54%), Positives = 42/53 (79%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVV A +A+Q+GYK +F+ FF  GFP+M+  + +A++YL+I H +FAWH
Sbjct: 648 GASANVVAAAIAQQYGYKISFVQFFIYGFPMMLTSIFLATVYLLIAHSLFAWH 700


>AY069194-1|AAL39339.1|  634|Drosophila melanogaster GH25177p
           protein.
          Length = 634

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GA +N + A +A QHGYK +F +FF IGFP+M+  +V+ S YL+I H V +W+
Sbjct: 577 GAVSNEIIALIALQHGYKISFWHFFAIGFPLMLVTMVIGSGYLLIAHSVLSWN 629


>AE014134-3556|ABC65925.1|  607|Drosophila melanogaster CG31693-PB,
           isoform B protein.
          Length = 607

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GA +N + A +A QHGYK +F +FF IGFP+M+  +V+ S YL+I H V +W+
Sbjct: 550 GAVSNEIIALIALQHGYKISFWHFFAIGFPLMLVTMVIGSGYLLIAHSVLSWN 602


>AE014134-3555|AAN11139.2|  688|Drosophila melanogaster CG31693-PA,
           isoform A protein.
          Length = 688

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GA +N + A +A QHGYK +F +FF IGFP+M+  +V+ S YL+I H V +W+
Sbjct: 631 GAVSNEIIALIALQHGYKISFWHFFAIGFPLMLVTMVIGSGYLLIAHSVLSWN 683


>BT025092-1|ABE73263.1|  690|Drosophila melanogaster IP12954p
           protein.
          Length = 690

 Score = 62.1 bits (144), Expect = 7e-10
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           G+ AN   A V + HGYK TF +FF +GF IM+  +V+ S++LII H +F WH
Sbjct: 638 GSLANEFAAVVGKAHGYKITFRSFFVVGFLIMLFTVVICSIFLIIAHSIFDWH 690


>AE014296-442|AAF47636.1|  690|Drosophila melanogaster CG13801-PA
           protein.
          Length = 690

 Score = 62.1 bits (144), Expect = 7e-10
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           G+ AN   A V + HGYK TF +FF +GF IM+  +V+ S++LII H +F WH
Sbjct: 638 GSLANEFAAVVGKAHGYKITFRSFFVVGFLIMLFTVVICSIFLIIAHSIFDWH 690


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,984,962
Number of Sequences: 53049
Number of extensions: 793047
Number of successful extensions: 1678
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1678
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3231892257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -