SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118368-1|AAM48397.1|  478|Drosophila melanogaster RE11562p pro...   103   3e-22
AE013599-97|AAF57318.2|  478|Drosophila melanogaster CG17337-PA ...   103   3e-22

>AY118368-1|AAM48397.1|  478|Drosophila melanogaster RE11562p
           protein.
          Length = 478

 Score =  103 bits (246), Expect = 3e-22
 Identities = 48/87 (55%), Positives = 60/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD+L+ +GA TEL DVG QT+ +G+ +            DP K TV +YGHLDVQPALK 
Sbjct: 53  ADRLRSLGAETELADVGQQTLPNGQIIPLPKVLLGTLGKDPSKKTVLVYGHLDVQPALKE 112

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW T PFEL E + KL+GRG++DDKG
Sbjct: 113 DGWNTNPFELTEVDGKLFGRGASDDKG 139



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 25/38 (65%), Positives = 29/38 (76%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W+H I AY+     LPVN+KF+FE MEESGSEGL
Sbjct: 140 PVLCWIHAIEAYQKLNIALPVNVKFVFEGMEESGSEGL 177



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 23/41 (56%), Positives = 30/41 (73%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD LL+++   + F   VD+VCISDNYWLG  +PC+T GLR
Sbjct: 177 LDDLLLER--KDNFLADVDFVCISDNYWLGKKRPCLTYGLR 215



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHW 249
           L + F +VD  K+ Y   LK  V I SVS   + R +  RMV W
Sbjct: 8   LQKFFAFVDGKKEDYIGALKTVVGIQSVSAWPEKRGEIGRMVEW 51


>AE013599-97|AAF57318.2|  478|Drosophila melanogaster CG17337-PA
           protein.
          Length = 478

 Score =  103 bits (246), Expect = 3e-22
 Identities = 48/87 (55%), Positives = 60/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD+L+ +GA TEL DVG QT+ +G+ +            DP K TV +YGHLDVQPALK 
Sbjct: 53  ADRLRSLGAETELADVGQQTLPNGQIIPLPKVLLGTLGKDPSKKTVLVYGHLDVQPALKE 112

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW T PFEL E + KL+GRG++DDKG
Sbjct: 113 DGWNTNPFELTEVDGKLFGRGASDDKG 139



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 25/38 (65%), Positives = 29/38 (76%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W+H I AY+     LPVN+KF+FE MEESGSEGL
Sbjct: 140 PVLCWIHAIEAYQKLNIALPVNVKFVFEGMEESGSEGL 177



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 23/41 (56%), Positives = 30/41 (73%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD LL+++   + F   VD+VCISDNYWLG  +PC+T GLR
Sbjct: 177 LDDLLLER--KDNFLADVDFVCISDNYWLGKKRPCLTYGLR 215



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHW 249
           L + F +VD  K+ Y   LK  V I SVS   + R +  RMV W
Sbjct: 8   LQKFFAFVDGKKEDYIGALKTVVGIQSVSAWPEKRGEIGRMVEW 51


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,091,625
Number of Sequences: 53049
Number of extensions: 751628
Number of successful extensions: 1820
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1729
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1818
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3375989364
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -