SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001419-1|AAN71174.1|  121|Drosophila melanogaster GH12784p pro...   116   4e-26
AE014297-4582|AAN14227.1|  121|Drosophila melanogaster CG2216-PE...   116   4e-26
Y15629-1|CAA75724.1|  205|Drosophila melanogaster ferritin subun...   114   9e-26
U91524-1|AAB70121.1|  205|Drosophila melanogaster ferritin subun...   114   9e-26
AY061831-1|AAL27642.1|  205|Drosophila melanogaster LD25232p pro...   114   9e-26
AF145125-1|AAF07877.1|  180|Drosophila melanogaster ferritin 1 h...   114   9e-26
AE014297-4581|AAF57036.1|  205|Drosophila melanogaster CG2216-PD...   114   9e-26
AE014297-4580|AAF57037.1|  205|Drosophila melanogaster CG2216-PC...   114   9e-26
AE014297-4579|AAF57035.1|  205|Drosophila melanogaster CG2216-PB...   114   9e-26
AE014297-4578|AAF57034.1|  205|Drosophila melanogaster CG2216-PA...   114   9e-26
DQ373967-1|ABD19516.1|  186|Drosophila melanogaster ferritin 3 h...    58   9e-09
DQ373966-1|ABD19515.1|  186|Drosophila melanogaster ferritin 3 h...    58   9e-09
BT025000-1|ABE01230.1|  186|Drosophila melanogaster IP07551p pro...    58   9e-09
AE014298-1846|AAF48226.1|  186|Drosophila melanogaster CG4349-PA...    58   9e-09
AY070805-1|AAL48427.1|  227|Drosophila melanogaster AT19513p pro...    37   0.030
AF145124-1|AAF07876.1|  227|Drosophila melanogaster ferritin 2 l...    37   0.030
AE014297-4585|AAN14229.1|  227|Drosophila melanogaster CG1469-PC...    37   0.030
AE014297-4584|AAN14228.1|  227|Drosophila melanogaster CG1469-PB...    37   0.030
AE014297-4583|AAF57038.1|  227|Drosophila melanogaster CG1469-PA...    37   0.030
AF145126-2|AAF07879.1|  227|Drosophila melanogaster ferritin 2 l...    35   0.12 
AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-P...    31   2.0  
AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein.    31   2.0  
X85331-1|CAA59680.1|  437|Drosophila melanogaster msh protein.         29   6.1  

>BT001419-1|AAN71174.1|  121|Drosophila melanogaster GH12784p
           protein.
          Length = 121

 Score =  116 bits (278), Expect = 4e-26
 Identities = 56/89 (62%), Positives = 67/89 (75%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLITYRAPQTRR 524
           KL++YL MRG+LT  V+DLI    P +RR
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI--NVPVSRR 119


>AE014297-4582|AAN14227.1|  121|Drosophila melanogaster CG2216-PE,
           isoform E protein.
          Length = 121

 Score =  116 bits (278), Expect = 4e-26
 Identities = 56/89 (62%), Positives = 67/89 (75%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLITYRAPQTRR 524
           KL++YL MRG+LT  V+DLI    P +RR
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI--NVPVSRR 119


>Y15629-1|CAA75724.1|  205|Drosophila melanogaster ferritin subunit
           1 protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>U91524-1|AAB70121.1|  205|Drosophila melanogaster ferritin subunit
           1 protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>AY061831-1|AAL27642.1|  205|Drosophila melanogaster LD25232p
           protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>AF145125-1|AAF07877.1|  180|Drosophila melanogaster ferritin 1
           heavy chain homolog protein.
          Length = 180

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 8   DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 67

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 68  KLVEYLSMRGQLTEGVSDLI 87



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 93  AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 150


>AE014297-4581|AAF57036.1|  205|Drosophila melanogaster CG2216-PD,
           isoform D protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>AE014297-4580|AAF57037.1|  205|Drosophila melanogaster CG2216-PC,
           isoform C protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>AE014297-4579|AAF57035.1|  205|Drosophila melanogaster CG2216-PB,
           isoform B protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>AE014297-4578|AAF57034.1|  205|Drosophila melanogaster CG2216-PA,
           isoform A protein.
          Length = 205

 Score =  114 bits (275), Expect = 9e-26
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>DQ373967-1|ABD19516.1|  186|Drosophila melanogaster ferritin 3
           heavy chain-like proteinsubunit protein.
          Length = 186

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++C   +  QI  E+ AS QYLAM  +F    ++ PG  + F  A+ EEREHA K++ Y+
Sbjct: 22  KSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYM 81

Query: 456 LMRGKL 473
             RG L
Sbjct: 82  NKRGGL 87



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           S   AL+HA+K+E +V   + + +        D +L D++   FL EQ  G
Sbjct: 102 STLDALKHAMKMELEVNKHLLD-LHALAGKEADPNLCDFIEANFLQEQVDG 151


>DQ373966-1|ABD19515.1|  186|Drosophila melanogaster ferritin 3
           heavy chain-like proteinsubunit protein.
          Length = 186

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++C   +  QI  E+ AS QYLAM  +F    ++ PG  + F  A+ EEREHA K++ Y+
Sbjct: 22  KSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYM 81

Query: 456 LMRGKL 473
             RG L
Sbjct: 82  NKRGGL 87



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           S   AL+HA+K+E +V   + + +        D +L D++   FL EQ  G
Sbjct: 102 STLDALKHAMKMELEVNKHLLD-LHALAGKEADPNLCDFIEANFLQEQVDG 151


>BT025000-1|ABE01230.1|  186|Drosophila melanogaster IP07551p
           protein.
          Length = 186

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++C   +  QI  E+ AS QYLAM  +F    ++ PG  + F  A+ EEREHA K++ Y+
Sbjct: 22  KSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYM 81

Query: 456 LMRGKL 473
             RG L
Sbjct: 82  NKRGGL 87



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           S   AL+HA+K+E +V   + + +        D +L D++   FL EQ  G
Sbjct: 102 STLDALKHAMKMELEVNKHLLD-LHALAGKEADPNLCDFIEANFLQEQVDG 151


>AE014298-1846|AAF48226.1|  186|Drosophila melanogaster CG4349-PA
           protein.
          Length = 186

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++C   +  QI  E+ AS QYLAM  +F    ++ PG  + F  A+ EEREHA K++ Y+
Sbjct: 22  KSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYM 81

Query: 456 LMRGKL 473
             RG L
Sbjct: 82  NKRGGL 87



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           S   AL+HA+K+E +V   + + +        D +L D++   FL EQ  G
Sbjct: 102 STLDALKHAMKMELEVNKHLLD-LHALAGKEADPNLCDFIEANFLQEQVDG 151


>AY070805-1|AAL48427.1|  227|Drosophila melanogaster AT19513p
           protein.
          Length = 227

 Score = 36.7 bits (81), Expect = 0.030
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG +
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGI 117

Query: 474 TGSVTDLITYRAPQTRRG 527
               T   +  +  T+RG
Sbjct: 118 VDFNTRHESSGSVSTKRG 135


>AF145124-1|AAF07876.1|  227|Drosophila melanogaster ferritin 2
           light chain homolog protein.
          Length = 227

 Score = 36.7 bits (81), Expect = 0.030
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG +
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGI 117

Query: 474 TGSVTDLITYRAPQTRRG 527
               T   +  +  T+RG
Sbjct: 118 VDFNTRHESSGSVSTKRG 135


>AE014297-4585|AAN14229.1|  227|Drosophila melanogaster CG1469-PC,
           isoform C protein.
          Length = 227

 Score = 36.7 bits (81), Expect = 0.030
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG +
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGI 117

Query: 474 TGSVTDLITYRAPQTRRG 527
               T   +  +  T+RG
Sbjct: 118 VDFNTRHESSGSVSTKRG 135


>AE014297-4584|AAN14228.1|  227|Drosophila melanogaster CG1469-PB,
           isoform B protein.
          Length = 227

 Score = 36.7 bits (81), Expect = 0.030
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG +
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGI 117

Query: 474 TGSVTDLITYRAPQTRRG 527
               T   +  +  T+RG
Sbjct: 118 VDFNTRHESSGSVSTKRG 135


>AE014297-4583|AAF57038.1|  227|Drosophila melanogaster CG1469-PA,
           isoform A protein.
          Length = 227

 Score = 36.7 bits (81), Expect = 0.030
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG +
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGI 117

Query: 474 TGSVTDLITYRAPQTRRG 527
               T   +  +  T+RG
Sbjct: 118 VDFNTRHESSGSVSTKRG 135


>AF145126-2|AAF07879.1|  227|Drosophila melanogaster ferritin 2
           light chain homolog protein.
          Length = 227

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRG 115


>AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-PA,
            isoform A protein.
          Length = 2376

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +2

Query: 473  DRLRNRPHHVQGPANTSWESGASA 544
            DR++ R H +  PA++ WESGA +
Sbjct: 1702 DRVKERRHKLSMPADSDWESGAES 1725


>AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein.
          Length = 2376

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +2

Query: 473  DRLRNRPHHVQGPANTSWESGASA 544
            DR++ R H +  PA++ WESGA +
Sbjct: 1702 DRVKERRHKLSMPADSDWESGAES 1725


>X85331-1|CAA59680.1|  437|Drosophila melanogaster msh protein.
          Length = 437

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 3/69 (4%)
 Frame = +1

Query: 430 TRPSSLTTCS*GES*QAP*PTSSRTGPRKHVVGERRISPR---ARPQAGE*RHQQHPGGH 600
           T  ++ +  S   S   P P   R   R+H+   RR +PR   A   A    H QH    
Sbjct: 86  TSSAATSPISQASSTPPPPPAVGRPSSRQHLPSRRRRAPRPLAAGAHAAAAAHAQHQAMA 145

Query: 601 QDLREQLQR 627
             LR+Q Q+
Sbjct: 146 AQLRQQQQQ 154


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,957,048
Number of Sequences: 53049
Number of extensions: 629752
Number of successful extensions: 1709
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1628
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1701
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3087795150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -