SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U66358-1|AAC47472.1|  149|Drosophila melanogaster RpL27a protein.     101   7e-22
U66357-1|AAC47475.1|  149|Drosophila melanogaster ribosomal prot...   101   7e-22
AY071144-1|AAL48766.1|  149|Drosophila melanogaster RE17991p pro...   101   7e-22
AE014134-746|AAF51006.3|  149|Drosophila melanogaster CG15442-PA...   101   7e-22
X74484-1|CAA52601.1|  149|Drosophila melanogaster ribosomal prot...    99   3e-21
D10228-1|BAA01080.1|  761|Drosophila melanogaster Ets domain pro...    29   2.6  
BT029727-1|ABL75784.1|  288|Drosophila melanogaster IP17596p pro...    29   4.5  
EF058032-1|ABL84967.1|  796|Drosophila melanogaster Nup153 protein.    28   7.9  
EF058031-1|ABL84966.1|  796|Drosophila melanogaster Nup153 protein.    28   7.9  

>U66358-1|AAC47472.1|  149|Drosophila melanogaster RpL27a protein.
          Length = 149

 Score =  101 bits (241), Expect = 7e-22
 Identities = 45/74 (60%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  KKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFR 213
           +KKTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GMRNFH R
Sbjct: 6   RKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLR 65

Query: 214 KNKNFCPVLNLDKL 255
           +   F P +NLDKL
Sbjct: 66  RQHKFRPEINLDKL 79



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/88 (27%), Positives = 34/88 (38%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L ++ +F     L   W+LV  +   +       K PVI++VK            P +
Sbjct: 62  FHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPAR 121

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV                GG C+LSA
Sbjct: 122 PVIVKAKYFSKKAEDKIKKAGGVCLLSA 149


>U66357-1|AAC47475.1|  149|Drosophila melanogaster ribosomal protein
           RpL27a protein.
          Length = 149

 Score =  101 bits (241), Expect = 7e-22
 Identities = 45/74 (60%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  KKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFR 213
           +KKTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GMRNFH R
Sbjct: 6   RKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLR 65

Query: 214 KNKNFCPVLNLDKL 255
           +   F P +NLDKL
Sbjct: 66  RQHKFRPEINLDKL 79



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/88 (27%), Positives = 34/88 (38%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L ++ +F     L   W+LV  +   +       K PVI++VK            P +
Sbjct: 62  FHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPAR 121

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV                GG C+LSA
Sbjct: 122 PVIVKAKYFSKKAEDKIKKAGGVCLLSA 149


>AY071144-1|AAL48766.1|  149|Drosophila melanogaster RE17991p
           protein.
          Length = 149

 Score =  101 bits (241), Expect = 7e-22
 Identities = 45/74 (60%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  KKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFR 213
           +KKTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GMRNFH R
Sbjct: 6   RKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLR 65

Query: 214 KNKNFCPVLNLDKL 255
           +   F P +NLDKL
Sbjct: 66  RQHKFRPEINLDKL 79



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/88 (27%), Positives = 34/88 (38%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L ++ +F     L   W+LV  +   +       K PVI++VK            P +
Sbjct: 62  FHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPAR 121

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV                GG C+LSA
Sbjct: 122 PVIVKAKYFSKKAEDKIKKAGGVCLLSA 149


>AE014134-746|AAF51006.3|  149|Drosophila melanogaster CG15442-PA
           protein.
          Length = 149

 Score =  101 bits (241), Expect = 7e-22
 Identities = 45/74 (60%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  KKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFR 213
           +KKTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GMRNFH R
Sbjct: 6   RKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLR 65

Query: 214 KNKNFCPVLNLDKL 255
           +   F P +NLDKL
Sbjct: 66  RQHKFRPEINLDKL 79



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/88 (27%), Positives = 34/88 (38%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L ++ +F     L   W+LV  +   +       K PVI++VK            P +
Sbjct: 62  FHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPAR 121

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV                GG C+LSA
Sbjct: 122 PVIVKAKYFSKKAEDKIKKAGGVCLLSA 149


>X74484-1|CAA52601.1|  149|Drosophila melanogaster ribosomal protein
           L27a protein.
          Length = 149

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 44/74 (59%), Positives = 48/74 (64%)
 Frame = +1

Query: 34  KKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFR 213
           +KKTRKLRGHVS                 N GG HHHRIN DKYHPGYFGK+GMRNFH R
Sbjct: 6   RKKTRKLRGHVSHGHGRIGKHRKHPGGRGNLGGMHHHRINFDKYHPGYFGKVGMRNFHLR 65

Query: 214 KNKNFCPVLNLDKL 255
           +   F P +NLDKL
Sbjct: 66  RQHKFRPEINLDKL 79



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 24/88 (27%), Positives = 35/88 (39%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L ++ +F     L   W+LV  +   +       K PVI++VK            P +
Sbjct: 62  FHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPAR 121

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV              + GG C+LSA
Sbjct: 122 PVIVKAKYFSKKAEDKIKEAGGVCLLSA 149


>D10228-1|BAA01080.1|  761|Drosophila melanogaster Ets domain
           protein protein.
          Length = 761

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +2

Query: 317 RHQYCQSWILQVARQRQTPQTTCHSKSKVLLKIS 418
           RH  C+   + +A  R+TP  TC S+ + +L+ S
Sbjct: 710 RHSQCRWKAIAMAASRRTPSDTCSSRRRSVLRQS 743


>BT029727-1|ABL75784.1|  288|Drosophila melanogaster IP17596p
           protein.
          Length = 288

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%)
 Frame = -1

Query: 283 SLVCSETNVQAYLSSKLDRNSCSF*SG----NFSYQVCQSI--QDGTCPC 152
           ++ CS +N Q   SSK D N CS  +G    N +  +C  I      CPC
Sbjct: 100 NISCSSSNTQPITSSKSDCN-CSHSAGTQSCNCNCNICNKINCSSSNCPC 148


>EF058032-1|ABL84967.1|  796|Drosophila melanogaster Nup153 protein.
          Length = 796

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +1

Query: 127 GGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKN 225
           GG+     +M++YH    G  G+R  H+  N N
Sbjct: 410 GGDSQSESDMNEYHDNGEGHDGLRPSHYNSNSN 442


>EF058031-1|ABL84966.1|  796|Drosophila melanogaster Nup153 protein.
          Length = 796

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +1

Query: 127 GGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKN 225
           GG+     +M++YH    G  G+R  H+  N N
Sbjct: 410 GGDSQSESDMNEYHDNGEGHDGLRPSHYNSNSN 442


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,134,911
Number of Sequences: 53049
Number of extensions: 434377
Number of successful extensions: 1549
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1258
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1457
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1721789184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -