SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071239-1|AAL48861.1|   64|Drosophila melanogaster RE27904p pro...   100   2e-21
AE014296-593|AAN11541.1|   64|Drosophila melanogaster CG32276-PB...   100   2e-21
AE014296-592|AAN11540.1|   64|Drosophila melanogaster CG32276-PA...   100   2e-21

>AY071239-1|AAL48861.1|   64|Drosophila melanogaster RE27904p
           protein.
          Length = 64

 Score =  100 bits (240), Expect = 2e-21
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQ
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQ 56


>AE014296-593|AAN11541.1|   64|Drosophila melanogaster CG32276-PB,
           isoform B protein.
          Length = 64

 Score =  100 bits (240), Expect = 2e-21
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQ
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQ 56


>AE014296-592|AAN11540.1|   64|Drosophila melanogaster CG32276-PA,
           isoform A protein.
          Length = 64

 Score =  100 bits (240), Expect = 2e-21
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQ
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQ 56


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,311,155
Number of Sequences: 53049
Number of extensions: 626657
Number of successful extensions: 1584
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1537
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1584
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3026039247
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -