SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071208-1|AAL48830.1|  111|Drosophila melanogaster RE25263p pro...    69   7e-12
AE014134-3014|AAN11021.1|  111|Drosophila melanogaster CG10652-P...    69   7e-12
AE014134-3013|AAF53738.1|  111|Drosophila melanogaster CG10652-P...    69   7e-12
AY118425-1|AAM48454.1|  111|Drosophila melanogaster RH09938p pro...    67   3e-11

>AY071208-1|AAL48830.1|  111|Drosophila melanogaster RE25263p
           protein.
          Length = 111

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 32/42 (76%), Positives = 35/42 (83%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVA KKQKK +ES N+RLALVMKSGKYCLGYKQTLK   + K
Sbjct: 1   MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGK 42



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLRQGKAKLV+IA N P LR
Sbjct: 25  GKYCLGYKQTLKTLRQGKAKLVLIASNTPALR 56


>AE014134-3014|AAN11021.1|  111|Drosophila melanogaster CG10652-PB,
           isoform B protein.
          Length = 111

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 32/42 (76%), Positives = 35/42 (83%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVA KKQKK +ES N+RLALVMKSGKYCLGYKQTLK   + K
Sbjct: 1   MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGK 42



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLRQGKAKLV+IA N P LR
Sbjct: 25  GKYCLGYKQTLKTLRQGKAKLVLIASNTPALR 56


>AE014134-3013|AAF53738.1|  111|Drosophila melanogaster CG10652-PA,
           isoform A protein.
          Length = 111

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 32/42 (76%), Positives = 35/42 (83%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVA KKQKK +ES N+RLALVMKSGKYCLGYKQTLK   + K
Sbjct: 1   MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGK 42



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLRQGKAKLV+IA N P LR
Sbjct: 25  GKYCLGYKQTLKTLRQGKAKLVLIASNTPALR 56


>AY118425-1|AAM48454.1|  111|Drosophila melanogaster RH09938p
           protein.
          Length = 111

 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 31/42 (73%), Positives = 34/42 (80%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVA KKQKK +ES N+RL LVMKSGKYCLGYKQTLK   + K
Sbjct: 1   MVAVKKQKKALESTNARLELVMKSGKYCLGYKQTLKTLRQGK 42



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLRQGKAKLV+IA N P LR
Sbjct: 25  GKYCLGYKQTLKTLRQGKAKLVLIASNTPALR 56


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,334,059
Number of Sequences: 53049
Number of extensions: 614172
Number of successful extensions: 1113
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1075
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1113
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3520086471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -