SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...   292   3e-79
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...   292   3e-79
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...   292   3e-79
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...   292   3e-79
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...   292   3e-79
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...   291   8e-79
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...   291   8e-79
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...   291   8e-79
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...   289   2e-78
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...   283   2e-76
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...   283   2e-76
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...   160   1e-39
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...   160   1e-39
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   153   2e-37
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   153   2e-37
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   149   4e-36
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...   144   1e-34
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...   144   1e-34
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    77   2e-14
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    77   2e-14
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    77   2e-14
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    75   7e-14
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    75   7e-14
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    75   7e-14
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    43   5e-04
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    43   5e-04
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    43   5e-04
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    43   5e-04
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    43   5e-04
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    43   5e-04
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    39   0.006
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    39   0.006
AY119172-1|AAM51032.1|  669|Drosophila melanogaster RH49745p pro...    37   0.024
AE013599-2642|AAM68183.1|  669|Drosophila melanogaster CG5729-PB...    37   0.024
AE013599-2641|AAF57733.1|  669|Drosophila melanogaster CG5729-PA...    37   0.024
AF165153-1|AAD51291.1|  669|Drosophila melanogaster DGP-1 protei...    37   0.031
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    37   0.031
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    36   0.055
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    36   0.055
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    35   0.13 
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    33   0.29 
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    33   0.29 
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    33   0.29 
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    33   0.29 
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    33   0.29 
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    33   0.29 
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    33   0.29 
V00204-1|CAA23491.1|  522|Drosophila melanogaster protein H prot...    29   8.3  
M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.    29   8.3  
BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p pro...    29   8.3  
AY564905-1|AAS73916.1|  242|Drosophila melanogaster 5-HT1A protein.    29   8.3  
AY070626-1|AAL48097.2|  582|Drosophila melanogaster RE72980p pro...    29   8.3  
AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB...    29   8.3  
AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA...    29   8.3  
AE013599-651|AAF59089.3|  577|Drosophila melanogaster CG8696-PA ...    29   8.3  

>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score =  292 bits (717), Expect = 3e-79
 Identities = 144/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score =  292 bits (717), Expect = 3e-79
 Identities = 144/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score =  292 bits (717), Expect = 3e-79
 Identities = 144/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score =  292 bits (717), Expect = 3e-79
 Identities = 144/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score =  292 bits (717), Expect = 3e-79
 Identities = 144/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score =  291 bits (713), Expect = 8e-79
 Identities = 143/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKE 173



 Score =  136 bits (329), Expect = 3e-32
 Identities = 60/65 (92%), Positives = 62/65 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDA
Sbjct: 175 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDA 234

Query: 690 ILPPA 704
           ILPPA
Sbjct: 235 ILPPA 239


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score =  291 bits (713), Expect = 8e-79
 Identities = 143/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKE 173



 Score =  136 bits (329), Expect = 3e-32
 Identities = 60/65 (92%), Positives = 62/65 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDA
Sbjct: 175 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDA 234

Query: 690 ILPPA 704
           ILPPA
Sbjct: 235 ILPPA 239


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score =  291 bits (713), Expect = 8e-79
 Identities = 143/166 (86%), Positives = 147/166 (88%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKE 173



 Score =  136 bits (329), Expect = 3e-32
 Identities = 60/65 (92%), Positives = 62/65 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDA
Sbjct: 175 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDA 234

Query: 690 ILPPA 704
           ILPPA
Sbjct: 235 ILPPA 239


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score =  289 bits (710), Expect = 2e-78
 Identities = 143/166 (86%), Positives = 146/166 (87%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLI AAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIDAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKE
Sbjct: 128 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKE 173



 Score =  137 bits (331), Expect = 2e-32
 Identities = 59/64 (92%), Positives = 62/64 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDA
Sbjct: 175 SSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDA 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score =  283 bits (693), Expect = 2e-76
 Identities = 140/166 (84%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKN QTREHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKE
Sbjct: 128 SKNDQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKE 173



 Score =  133 bits (321), Expect = 3e-31
 Identities = 57/65 (87%), Positives = 61/65 (93%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKK+GYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+V RKEG ADGK L++ALDA
Sbjct: 175 SSYIKKVGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWEVGRKEGNADGKTLVDALDA 234

Query: 690 ILPPA 704
           ILPPA
Sbjct: 235 ILPPA 239


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score =  283 bits (693), Expect = 2e-76
 Identities = 140/166 (84%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKN QTREHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKE
Sbjct: 128 SKNDQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKE 173



 Score =  133 bits (321), Expect = 3e-31
 Identities = 57/65 (87%), Positives = 61/65 (93%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKK+GYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+V RKEG ADGK L++ALDA
Sbjct: 175 SSYIKKVGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWEVGRKEGNADGKTLVDALDA 234

Query: 690 ILPPA 704
           ILPPA
Sbjct: 235 ILPPA 239


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =  160 bits (389), Expect = 1e-39
 Identities = 79/166 (47%), Positives = 110/166 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  I+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+  
Sbjct: 245 KSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETG 304

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER R          +     +   +DAPGH+DFI NMI+G +QAD A+L+V A  GEFE
Sbjct: 305 EERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFE 364

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           +G    GQTREHA+L  +LGV QL V +NK+D+    +S+ RF EI
Sbjct: 365 SGFELGGQTREHAILVRSLGVNQLGVVINKLDTV--GWSQDRFTEI 408


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =  160 bits (389), Expect = 1e-39
 Identities = 79/166 (47%), Positives = 110/166 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  I+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+  
Sbjct: 245 KSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETG 304

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER R          +     +   +DAPGH+DFI NMI+G +QAD A+L+V A  GEFE
Sbjct: 305 EERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFE 364

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           +G    GQTREHA+L  +LGV QL V +NK+D+    +S+ RF EI
Sbjct: 365 SGFELGGQTREHAILVRSLGVNQLGVVINKLDTV--GWSQDRFTEI 408


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  153 bits (371), Expect = 2e-37
 Identities = 75/167 (44%), Positives = 105/167 (62%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  +
Sbjct: 193 REHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTNQ 252

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER++              +     +DAPGH+ F+ NMI G +QAD AVL+++A  GEFE
Sbjct: 253 EERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFE 312

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            G  + GQTREHA+LA T GVK L+V VNKMD     + + R+ E K
Sbjct: 313 TGFDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECK 359



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 3/40 (7%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLE--PSTKMPWFKG 626
           Y+KK+G+NPA  + F+P SG  G  + +  P T  PW++G
Sbjct: 365 YLKKLGFNPAKDLTFMPCSGLSGYGLKDQIPETLCPWYRG 404


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  153 bits (371), Expect = 2e-37
 Identities = 75/167 (44%), Positives = 105/167 (62%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  +
Sbjct: 193 REHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTNQ 252

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER++              +     +DAPGH+ F+ NMI G +QAD AVL+++A  GEFE
Sbjct: 253 EERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFE 312

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            G  + GQTREHA+LA T GVK L+V VNKMD     + + R+ E K
Sbjct: 313 TGFDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECK 359



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 3/40 (7%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLE--PSTKMPWFKG 626
           Y+KK+G+NPA  + F+P SG  G  + +  P T  PW++G
Sbjct: 365 YLKKLGFNPAKDLTFMPCSGLSGYGLKDQIPETLCPWYRG 404


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  149 bits (361), Expect = 4e-36
 Identities = 80/196 (40%), Positives = 114/196 (58%), Gaps = 3/196 (1%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +N+V IGHVD+GKST  G ++   G + KRT+EK+E+EA+E  + S+  +W LD  +
Sbjct: 193 REHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKYEREAREKSRESWYLSWGLDTNQ 252

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER++              +     +DAPGH+ F+ NMI G +QAD AVL+++A  GEFE
Sbjct: 253 EERDKGKTVGVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFE 312

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLA-- 534
            G  + GQTREHA+LA T GVK L+V VNKMD     + + R+ E K +     ++L   
Sbjct: 313 TGFDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFN 372

Query: 535 -TTQLLSLSCPFLDGT 579
               L  + C  L GT
Sbjct: 373 PAKDLTFMPCSGLSGT 388


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score =  144 bits (348), Expect = 1e-34
 Identities = 69/72 (95%), Positives = 71/72 (98%)
 Frame = +1

Query: 292 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPP
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 472 YSEPRFEEIKKE 507
           YSE R+EEIKKE
Sbjct: 61  YSEARYEEIKKE 72



 Score =  136 bits (329), Expect = 3e-32
 Identities = 60/65 (92%), Positives = 62/65 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDA
Sbjct: 74  SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDA 133

Query: 690 ILPPA 704
           ILPPA
Sbjct: 134 ILPPA 138


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score =  144 bits (348), Expect = 1e-34
 Identities = 69/72 (95%), Positives = 71/72 (98%)
 Frame = +1

Query: 292 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPP
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 472 YSEPRFEEIKKE 507
           YSE R+EEIKKE
Sbjct: 61  YSEARYEEIKKE 72



 Score =  136 bits (329), Expect = 3e-32
 Identities = 60/65 (92%), Positives = 62/65 (95%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDA
Sbjct: 74  SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDA 133

Query: 690 ILPPA 704
           ILPPA
Sbjct: 134 ILPPA 138


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 77.4 bits (182), Expect = 2e-14
 Identities = 53/151 (35%), Positives = 76/151 (50%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T         I K   +K   E+++  +        +D    E+ 
Sbjct: 84  NVGTIGHVDHGKTTLTA-------AITKVLADKQLAESKKYNE--------IDNAPEEKA 128

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R        +E +       H D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
              QTREH LLA  +G+  ++V +NK+D+ +
Sbjct: 185 ---QTREHMLLAKQIGIDHIVVFINKVDAAD 212


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 77.4 bits (182), Expect = 2e-14
 Identities = 53/151 (35%), Positives = 76/151 (50%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T         I K   +K   E+++  +        +D    E+ 
Sbjct: 84  NVGTIGHVDHGKTTLTA-------AITKVLADKQLAESKKYNE--------IDNAPEEKA 128

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R        +E +       H D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
              QTREH LLA  +G+  ++V +NK+D+ +
Sbjct: 185 ---QTREHMLLAKQIGIDHIVVFINKVDAAD 212


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 77.4 bits (182), Expect = 2e-14
 Identities = 53/151 (35%), Positives = 76/151 (50%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T         I K   +K   E+++  +        +D    E+ 
Sbjct: 84  NVGTIGHVDHGKTTLTA-------AITKVLADKQLAESKKYNE--------IDNAPEEKA 128

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R        +E +       H D PGH D+IKNMITGT+Q D A+L+VAA  G       
Sbjct: 129 RGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP---- 184

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
              QTREH LLA  +G+  ++V +NK+D+ +
Sbjct: 185 ---QTREHMLLAKQIGIDHIVVFINKVDAAD 212


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 51/148 (34%), Positives = 73/148 (49%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T              I + + +    G   +     +D+   E+ 
Sbjct: 59  NVGTIGHVDHGKTTLTA------------AITRIQSQK---GLAEYLSYDQIDRAPEEKA 103

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R      C +     +    H D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTREH LLA  +G++++IV +NK D
Sbjct: 160 ---QTREHLLLAKQVGIQRIIVFINKAD 184


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 51/148 (34%), Positives = 73/148 (49%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T              I + + +    G   +     +D+   E+ 
Sbjct: 59  NVGTIGHVDHGKTTLTA------------AITRIQSQK---GLAEYLSYDQIDRAPEEKA 103

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R      C +     +    H D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTREH LLA  +G++++IV +NK D
Sbjct: 160 ---QTREHLLLAKQVGIQRIIVFINKAD 184


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 51/148 (34%), Positives = 73/148 (49%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T              I + + +    G   +     +D+   E+ 
Sbjct: 59  NVGTIGHVDHGKTTLTA------------AITRIQSQK---GLAEYLSYDQIDRAPEEKA 103

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R      C +     +    H D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTREH LLA  +G++++IV +NK D
Sbjct: 160 ---QTREHLLLAKQVGIQRIIVFINKAD 184


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 185

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 186 ILQNKIDLIKESQAKEQYEEITK 208


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 124 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 177

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 178 ILQNKIDLIKESQAKEQYEEITK 200


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 185

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 186 ILQNKIDLIKESQAKEQYEEITK 208


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 185

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 186 ILQNKIDLIKESQAKEQYEEITK 208


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 124 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 177

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 178 ILQNKIDLIKESQAKEQYEEITK 200


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +KQ++
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKQIL 185

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++EEI K
Sbjct: 186 ILQNKIDLIKESQAKEQYEEITK 208


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 33/128 (25%), Positives = 54/128 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  +++  G I          E  E+ +G       +D ++ ER+
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTGRI---------AEMHEV-RGKDNVGATMDSMELERQ 93

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +            ID PGH DF   +       D AVL++ A  G     ++
Sbjct: 94  RGITIQSAATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSETLT 153

Query: 373 KNGQTREH 396
            N Q + +
Sbjct: 154 VNRQMKRY 161


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 33/128 (25%), Positives = 54/128 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  +++  G I          E  E+ +G       +D ++ ER+
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTGRI---------AEMHEV-RGKDNVGATMDSMELERQ 93

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +            ID PGH DF   +       D AVL++ A  G     ++
Sbjct: 94  RGITIQSAATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQTLT 153

Query: 373 KNGQTREH 396
            N Q + +
Sbjct: 154 VNRQMKRY 161


>AY119172-1|AAM51032.1|  669|Drosophila melanogaster RH49745p
           protein.
          Length = 669

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 9/159 (5%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIY----KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL-- 168
           EI + V+G+VD+GKST  G L +       G  ++ + + + E  E G+ S     +L  
Sbjct: 143 EIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEI-ESGRTSSVGNDILGF 201

Query: 169 DKLKAERERRYHNRYCSLEV-RN*QVLCYHIDAPGHRDFIKNMITG-TSQA-DCAVLIVA 339
           D +     +  H     +++  N   +   ID  GH  ++K  + G T  A D  +L++ 
Sbjct: 202 DGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIG 261

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           A  G         G T+EH  LA  L V   +V V K+D
Sbjct: 262 ANAGII-------GMTKEHLGLALALAVPVFVV-VTKID 292


>AE013599-2642|AAM68183.1|  669|Drosophila melanogaster CG5729-PB,
           isoform B protein.
          Length = 669

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 9/159 (5%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIY----KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL-- 168
           EI + V+G+VD+GKST  G L +       G  ++ + + + E  E G+ S     +L  
Sbjct: 143 EIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEI-ESGRTSSVGNDILGF 201

Query: 169 DKLKAERERRYHNRYCSLEV-RN*QVLCYHIDAPGHRDFIKNMITG-TSQA-DCAVLIVA 339
           D +     +  H     +++  N   +   ID  GH  ++K  + G T  A D  +L++ 
Sbjct: 202 DGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIG 261

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           A  G         G T+EH  LA  L V   +V V K+D
Sbjct: 262 ANAGII-------GMTKEHLGLALALAVPVFVV-VTKID 292


>AE013599-2641|AAF57733.1|  669|Drosophila melanogaster CG5729-PA,
           isoform A protein.
          Length = 669

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 9/159 (5%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIY----KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL-- 168
           EI + V+G+VD+GKST  G L +       G  ++ + + + E  E G+ S     +L  
Sbjct: 143 EIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEI-ESGRTSSVGNDILGF 201

Query: 169 DKLKAERERRYHNRYCSLEV-RN*QVLCYHIDAPGHRDFIKNMITG-TSQA-DCAVLIVA 339
           D +     +  H     +++  N   +   ID  GH  ++K  + G T  A D  +L++ 
Sbjct: 202 DGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIG 261

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           A  G         G T+EH  LA  L V   +V V K+D
Sbjct: 262 ANAGII-------GMTKEHLGLALALAVPVFVV-VTKID 292


>AF165153-1|AAD51291.1|  669|Drosophila melanogaster DGP-1 protein
           protein.
          Length = 669

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 45/159 (28%), Positives = 71/159 (44%), Gaps = 9/159 (5%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIY----KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL-- 168
           EI + V+G+VD+GKST  G L +       G  +  + + + E  E G+ S     +L  
Sbjct: 143 EIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARHRLFRHKHEI-ESGRTSSVGNDILGF 201

Query: 169 DKLKAERERRYHNRYCSLEV-RN*QVLCYHIDAPGHRDFIKNMITG-TSQA-DCAVLIVA 339
           D +     +  H     +++  N   +   ID  GH  ++K  + G T  A D  +L++ 
Sbjct: 202 DGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIG 261

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           A  G         G T+EH  LA  L V   +V V K+D
Sbjct: 262 ANAGII-------GMTKEHLGLALALAVPVFVV-VTKID 292


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK---FEKEAQEMGKGSFKYAWVLDKLKA 183
           NI ++ HVD GK+T    L+   G I +R   K    +  + E  +G          +K+
Sbjct: 21  NICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQERGI--------TMKS 72

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
                Y+     +   N   L   ID+PGH DF   + T     D A+++V
Sbjct: 73  SSISLYYQEAEEM-AGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 122


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 35.9 bits (79), Expect = 0.055
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+LI
Sbjct: 72  VDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKKLI 123

Query: 436 VGVNKMD 456
           V +NK+D
Sbjct: 124 VVINKID 130


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 35.9 bits (79), Expect = 0.055
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+LI
Sbjct: 72  VDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKKLI 123

Query: 436 VGVNKMD 456
           V +NK+D
Sbjct: 124 VVINKID 130


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 1/157 (0%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  +++  G    +T     +   E+ +G+     V D L  ERE
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG----KT-----RALGEVHRGN----TVTDYLTQERE 81

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA-GI 369
           R       ++           +D PGH DF   +       D  V++V  GT   EA  +
Sbjct: 82  RGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVEQSLYAVD-GVVVVLDGTAGVEAQTV 140

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 480
           +   Q  +H L          ++ VNKMD  +  + +
Sbjct: 141 TVWSQADKHKL--------PRLIFVNKMDRPDADFEK 169


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE        A  +   
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFE 80

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E++  +       E      L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  VEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 27/70 (38%), Positives = 33/70 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V  +I
Sbjct: 215 LDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV-PII 266

Query: 436 VGVNKMDSTE 465
           V +NK+D  E
Sbjct: 267 VALNKIDKPE 276


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE        A  +   
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFE 80

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E++  +       E      L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  VEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 27/70 (38%), Positives = 33/70 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V  +I
Sbjct: 215 LDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV-PII 266

Query: 436 VGVNKMDSTE 465
           V +NK+D  E
Sbjct: 267 VALNKIDKPE 276


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE        A  +   
Sbjct: 9   NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFE 68

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E++  +       E      L   ID+PGH DF   +       D A+++V   +G
Sbjct: 69  VEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE        A  +   
Sbjct: 9   NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFE 68

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E++  +       E      L   ID+PGH DF   +       D A+++V   +G
Sbjct: 69  VEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 33.5 bits (73), Expect = 0.29
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE        A  +   
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFE 80

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E++  +       E      L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  VEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>V00204-1|CAA23491.1|  522|Drosophila melanogaster protein H
           protein.
          Length = 522

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = -3

Query: 531 QSS*CMRIFLLDFLKSGLTVWWFSGIHFVYSYDELFDTEGE---SEQGMLTGLTVLRDTS 361
           QS+ C+ + ++ F+  G T WW SG ++        D++G+      G+   L  L+D  
Sbjct: 4   QSAACLLLAIVGFV--GATEWWESGNYYQIYPRSFRDSDGDGIGDLNGVTEKLQYLKDIG 61

Query: 360 FEFTGT 343
             FTGT
Sbjct: 62  --FTGT 65


>M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.
          Length = 993

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 440 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 342
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


>BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p
           protein.
          Length = 683

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 440 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 342
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 93  PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 125


>AY564905-1|AAS73916.1|  242|Drosophila melanogaster 5-HT1A protein.
          Length = 242

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 27/128 (21%), Positives = 49/128 (38%), Gaps = 1/128 (0%)
 Frame = +1

Query: 250 YHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 429
           Y+       DFI ++       D       AG+    A ++    +   A  A  +  K 
Sbjct: 73  YYSSGKRRADFIGSLALKPPPTDANTTTTTAGSPLATAALAAAAASASVAAAAARITAKA 132

Query: 430 LIVGVN-KMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTETTCWSLQP 606
               +  K D+T  P S P  + I  ++ +T+  +    +L      L+G ++   SL  
Sbjct: 133 AHRALTTKQDATSSPASSPALQXIDMDNXYTNVAVGLGXMLLNDTLLLEGNDS---SLFG 189

Query: 607 KCLGSRDG 630
           + L +R G
Sbjct: 190 EMLANRSG 197


>AY070626-1|AAL48097.2|  582|Drosophila melanogaster RE72980p
           protein.
          Length = 582

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = -3

Query: 531 QSS*CMRIFLLDFLKSGLTVWWFSGIHFVYSYDELFDTEGE---SEQGMLTGLTVLRDTS 361
           QS+ C+ + ++ F+  G T WW SG ++        D++G+      G+   L  L+D  
Sbjct: 9   QSAACLLLAIVGFV--GATEWWESGNYYQIYPRSFRDSDGDGIGDLNGVTEKLQYLKDIG 66

Query: 360 FEFTGT 343
             FTGT
Sbjct: 67  --FTGT 70


>AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB,
           isoform B protein.
          Length = 885

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 440 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 342
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 295 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 327


>AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA,
           isoform A protein.
          Length = 954

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 440 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 342
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


>AE013599-651|AAF59089.3|  577|Drosophila melanogaster CG8696-PA
           protein.
          Length = 577

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = -3

Query: 531 QSS*CMRIFLLDFLKSGLTVWWFSGIHFVYSYDELFDTEGE---SEQGMLTGLTVLRDTS 361
           QS+ C+ + ++ F+  G T WW SG ++        D++G+      G+   L  L+D  
Sbjct: 4   QSAACLLLAIVGFV--GATEWWESGNYYQIYPRSFRDSDGDGIGDLNGVTEKLQYLKDIG 61

Query: 360 FEFTGT 343
             FTGT
Sbjct: 62  --FTGT 65


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,817,056
Number of Sequences: 53049
Number of extensions: 771398
Number of successful extensions: 2521
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 2314
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2477
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3170136354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -