SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p pro...   137   1e-32
AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA ...   137   1e-32
X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic tra...   136   3e-32
AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p pro...   136   3e-32
AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p pro...   136   3e-32
AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic i...   136   3e-32
AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD...   136   3e-32
AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB...   136   3e-32
AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC...   136   3e-32
AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA...   136   3e-32
AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box hel...    64   2e-10
X52846-1|CAA37037.1|  575|Drosophila melanogaster protein ( Dros...    60   4e-09
BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p pro...    60   4e-09
BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p pro...    60   4e-09
BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p pro...    60   4e-09
AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF...    60   4e-09
AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC...    60   4e-09
AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB...    60   4e-09
AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE...    60   4e-09
AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD...    60   4e-09
AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA...    60   4e-09
X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.        49   7e-06
M23560-1|AAA29013.1|  648|Drosophila melanogaster protein ( D.me...    49   7e-06
AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p pro...    49   7e-06
AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p pro...    49   7e-06
AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p pro...    49   7e-06
AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-P...    49   7e-06
AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-P...    49   7e-06
AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA...    49   7e-06
M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase p...    47   3e-05
AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p pro...    47   3e-05
AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB...    47   3e-05
AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA...    47   3e-05
AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p pro...    46   4e-05
AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-P...    46   4e-05
X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.         46   7e-05
L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family pu...    46   7e-05
AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p pro...    46   7e-05
AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,...    46   7e-05
AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,...    46   7e-05
AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,...    46   7e-05
AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p pro...    45   9e-05
AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p pro...    45   9e-05
AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA ...    45   9e-05
AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB...    45   9e-05
AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p pro...    43   5e-04
AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556...    37   0.024
AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA...    37   0.024
U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box prote...    37   0.031
BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p pro...    37   0.031
AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p pro...    37   0.031
AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-P...    37   0.031
AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA...    36   0.055
Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box prote...    36   0.072
L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box prote...    36   0.072
BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p pro...    36   0.072
AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p pro...    36   0.072
AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p pro...    36   0.072
AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA...    36   0.072
AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA...    36   0.072
AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p pro...    33   0.39 
AF057167-1|AAD09429.1|  270|Drosophila melanogaster DEAD-box pro...    33   0.39 
AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA...    33   0.39 
BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p pro...    31   1.2  
AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p pro...    31   1.2  
AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt pro...    31   1.2  
AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box pro...    31   1.2  
AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM0530...    31   1.2  
AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA ...    31   1.2  
AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA ...    31   1.2  
BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p pro...    31   2.1  
AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p pro...    31   2.1  
AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA...    31   2.1  
AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA...    31   2.1  
U92536-1|AAD41441.1| 1487|Drosophila melanogaster RECQ helicase ...    30   2.7  
AE014297-1368|AAF54691.1| 1487|Drosophila melanogaster CG6920-PA...    30   2.7  
AE014298-1910|AAF48274.2|  142|Drosophila melanogaster CG12726-P...    30   3.6  
AE014298-914|AAF46176.1|  438|Drosophila melanogaster CG14443-PA...    30   3.6  
M74824-1|AAC14192.1|  644|Drosophila melanogaster D-E-A-D box pr...    29   4.7  
BT010045-1|AAQ22514.1|  687|Drosophila melanogaster LD27814p pro...    29   4.7  
AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH0283...    29   4.7  
AF132173-1|AAD34761.1|  687|Drosophila melanogaster unknown prot...    29   4.7  
AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB...    29   4.7  
AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA...    29   4.7  
AE014296-2792|AAF49419.1|  687|Drosophila melanogaster CG9680-PA...    29   4.7  
AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p pro...    29   8.3  
AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p pro...    29   8.3  
AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB...    29   8.3  
AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA...    29   8.3  

>AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p
           protein.
          Length = 399

 Score =  137 bits (332), Expect = 1e-32
 Identities = 59/85 (69%), Positives = 72/85 (84%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 241 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 300

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ER+ IM++FR G SRVLITT  W
Sbjct: 301 QKERDEIMKEFRAGQSRVLITTDVW 325



 Score = 75.4 bits (177), Expect = 7e-14
 Identities = 40/74 (54%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDVQQVS VINYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 326 ARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYS 385

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 386 TQIDEMPVNVADLI 399


>AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA
           protein.
          Length = 399

 Score =  137 bits (332), Expect = 1e-32
 Identities = 59/85 (69%), Positives = 72/85 (84%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 241 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 300

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ER+ IM++FR G SRVLITT  W
Sbjct: 301 QKERDEIMKEFRAGQSRVLITTDVW 325



 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 40/74 (54%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDVQQVS VINYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 326 ARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYS 385

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 386 TQIDEMPMNVADLI 399


>X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic
           translation initiationfactor 4A (eIF-4A) protein.
          Length = 402

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 244 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 303

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 304 QRDREVIMKQFRSGSSRVLITT 325



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 327 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 386

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 387 YHTTIEEMPANIADLI 402


>AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p
           protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p
           protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic
           initiation factor-4a protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD,
           isoform D protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB,
           isoform B protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC,
           isoform C protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA,
           isoform A protein.
          Length = 403

 Score =  136 bits (329), Expect = 3e-32
 Identities = 61/82 (74%), Positives = 73/82 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E WKL TLCDLYDTLSI Q+VIFCNTRRKVD LT+ M + +FTVSAMHGDM+
Sbjct: 245 QFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDME 304

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+REVIM+QFR+GSSRVLITT
Sbjct: 305 QRDREVIMKQFRSGSSRVLITT 326



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/76 (61%), Positives = 54/76 (71%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLPSNRENY                 NF+T+ DRR LKDIE F
Sbjct: 328 LLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQF 387

Query: 436 YHTSIVEMPSDVANLI 483
           YHT+I EMP+++A+LI
Sbjct: 388 YHTTIEEMPANIADLI 403


>AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box
           helicase protein.
          Length = 460

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 28/82 (34%), Positives = 50/82 (60%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  + EE K   + ++Y  +S+ QA+IFC+T+R   WL   M     +V+ + GD+ 
Sbjct: 290 QYYVKCKNEEGKYNAIQNIYGCISVGQAIIFCHTKRTAAWLAAKMTSDGHSVAVLTGDLT 349

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR+G  +VLITT
Sbjct: 350 VVQRLDVLDRFRSGLEKVLITT 371



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 7/81 (8%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP------SNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRA 414
           +L+RGID++Q+  V+N+DLP      ++ E Y                 N +T E   + 
Sbjct: 373 ILSRGIDIEQLQVVVNFDLPVDLDGMADCETYLHRIGRTGRFGKSGIAINLITDEKTMKV 432

Query: 415 LKDIEDFYHTSIVEMPSDVAN 477
             DIE  ++  I  + +D A+
Sbjct: 433 CSDIEKHFNKKIEVLNTDSAD 453


>X52846-1|CAA37037.1|  575|Drosophila melanogaster protein (
           Drosophila melanogasterRM62 mRNA for novel RNA helicase.
           ).
          Length = 575

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 368 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 427

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 428 VLREFRSGKSNILVAT 443



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 447 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 506

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 507 EANQEINPALENL 519


>BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p
           protein.
          Length = 575

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 368 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 427

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 428 VLREFRSGKSNILVAT 443



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 447 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 506

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 507 EANQEINPALENL 519


>BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p
           protein.
          Length = 719

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 512 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 571

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 572 VLREFRSGKSNILVAT 587



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 591 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 650

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 651 EANQEINPALENL 663


>BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p
           protein.
          Length = 578

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 371 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 430

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 431 VLREFRSGKSNILVAT 446



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 450 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 509

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 510 EANQEINPALENL 522


>AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF,
           isoform F protein.
          Length = 578

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 371 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 430

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 431 VLREFRSGKSNILVAT 446



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 450 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 509

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 510 EANQEINPALENL 522


>AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC,
           isoform C protein.
          Length = 578

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 371 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 430

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 431 VLREFRSGKSNILVAT 446



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 450 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 509

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 510 EANQEINPALENL 522


>AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB,
           isoform B protein.
          Length = 578

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 371 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 430

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 431 VLREFRSGKSNILVAT 446



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 450 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 509

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 510 EANQEINPALENL 522


>AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE,
           isoform E protein.
          Length = 578

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 371 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 430

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 431 VLREFRSGKSNILVAT 446



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 450 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 509

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 510 EANQEINPALENL 522


>AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD,
           isoform D protein.
          Length = 575

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 368 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 427

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 428 VLREFRSGKSNILVAT 443



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 447 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 506

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 507 EANQEINPALENL 519


>AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA,
           isoform A protein.
          Length = 719

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 512 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 571

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 572 VLREFRSGKSNILVAT 587



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 591 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 650

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 651 EANQEINPALENL 663


>X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.
          Length = 661

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   +  ++F  +++HGD  Q +RE  +R F+ GS +VLI T
Sbjct: 493 IVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT 546



 Score = 32.7 bits (71), Expect = 0.51
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +  VINYD+PS  ++Y
Sbjct: 550 SRGLDIKNIKHVINYDMPSKIDDY 573


>M23560-1|AAA29013.1|  648|Drosophila melanogaster protein (
           D.melanogaster antigenMab46F11 (vasa) mRNA, complete
           cds. ).
          Length = 648

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   +  ++F  +++HGD  Q +RE  +R F+ GS +VLI T
Sbjct: 480 IVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT 533



 Score = 32.7 bits (71), Expect = 0.51
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +  VINYD+PS  ++Y
Sbjct: 537 SRGLDIKNIKHVINYDMPSKIDDY 560


>AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p
           protein.
          Length = 818

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           E  KL  L  L   +S     + +IF  T+++VD +T ++  + +   A+HGD  Q+ER+
Sbjct: 385 ENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERD 444

Query: 203 VIMRQFRTGSSRVLITT 253
            ++  FR G   +L+ T
Sbjct: 445 FVLSSFRNGRHSILVAT 461



 Score = 37.9 bits (84), Expect = 0.014
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV  V  VINYD PSN E+Y
Sbjct: 465 ARGLDVDDVKFVINYDYPSNSEDY 488


>AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p
           protein.
          Length = 376

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   +  ++F  +++HGD  Q +RE  +R F+ GS +VLI T
Sbjct: 208 IVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT 261



 Score = 32.7 bits (71), Expect = 0.51
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +  VINYD+PS  ++Y
Sbjct: 265 SRGLDIKNIKHVINYDMPSKIDDY 288


>AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p
           protein.
          Length = 157

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           E  KL  L  L   +S     + +IF  T+++VD +T ++  + +   A+HGD  Q+ER+
Sbjct: 70  ENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERD 129

Query: 203 VIMRQFRTGSSRVLITT 253
            ++  FR G   +L+ T
Sbjct: 130 FVLSSFRNGRHSILVAT 146


>AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-PB,
           isoform B protein.
          Length = 157

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           E  KL  L  L   +S     + +IF  T+++VD +T ++  + +   A+HGD  Q+ER+
Sbjct: 70  ENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERD 129

Query: 203 VIMRQFRTGSSRVLITT 253
            ++  FR G   +L+ T
Sbjct: 130 FVLSSFRNGRHSILVAT 146


>AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-PA,
           isoform A protein.
          Length = 818

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           E  KL  L  L   +S     + +IF  T+++VD +T ++  + +   A+HGD  Q+ER+
Sbjct: 385 ENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERD 444

Query: 203 VIMRQFRTGSSRVLITT 253
            ++  FR G   +L+ T
Sbjct: 445 FVLSSFRNGRHSILVAT 461



 Score = 37.9 bits (84), Expect = 0.014
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV  V  VINYD PSN E+Y
Sbjct: 465 ARGLDVDDVKFVINYDYPSNSEDY 488


>AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA
           protein.
          Length = 661

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   +  ++F  +++HGD  Q +RE  +R F+ GS +VLI T
Sbjct: 493 IVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT 546



 Score = 32.7 bits (71), Expect = 0.51
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +  VINYD+PS  ++Y
Sbjct: 550 SRGLDIKNIKHVINYDMPSKIDDY 573


>M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase
           protein.
          Length = 459

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    +    +H  
Sbjct: 269 GVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAK 328

Query: 182 MDQREREVIMRQFRTGSSRVLI 247
           M Q  R  +   FR G  R L+
Sbjct: 329 MAQAHRNRVFHDFRQGLCRNLV 350



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/69 (36%), Positives = 29/69 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGIDVQ V+ VIN+D P   E Y                 N +T  DR  L  IE  
Sbjct: 354 LFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKE 413

Query: 436 YHTSIVEMP 462
             T I  +P
Sbjct: 414 LGTEIKPIP 422


>AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p
           protein.
          Length = 459

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    +    +H  
Sbjct: 269 GVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAK 328

Query: 182 MDQREREVIMRQFRTGSSRVLI 247
           M Q  R  +   FR G  R L+
Sbjct: 329 MAQAHRNRVFHDFRQGLCRNLV 350



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/69 (36%), Positives = 29/69 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGIDVQ V+ VIN+D P   E Y                 N +T  DR  L  IE  
Sbjct: 354 LFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKE 413

Query: 436 YHTSIVEMP 462
             T I  +P
Sbjct: 414 LGTEIKPIP 422


>AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB,
           isoform B protein.
          Length = 428

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    +    +H  
Sbjct: 238 GVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAK 297

Query: 182 MDQREREVIMRQFRTGSSRVLI 247
           M Q  R  +   FR G  R L+
Sbjct: 298 MAQAHRNRVFHDFRQGLCRNLV 319



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/69 (36%), Positives = 29/69 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGIDVQ V+ VIN+D P   E Y                 N +T  DR  L  IE  
Sbjct: 323 LFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKE 382

Query: 436 YHTSIVEMP 462
             T I  +P
Sbjct: 383 LGTEIKPIP 391


>AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA,
           isoform A protein.
          Length = 459

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    +    +H  
Sbjct: 269 GVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAK 328

Query: 182 MDQREREVIMRQFRTGSSRVLI 247
           M Q  R  +   FR G  R L+
Sbjct: 329 MAQAHRNRVFHDFRQGLCRNLV 350



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/69 (36%), Positives = 29/69 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGIDVQ V+ VIN+D P   E Y                 N +T  DR  L  IE  
Sbjct: 354 LFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKE 413

Query: 436 YHTSIVEMP 462
             T I  +P
Sbjct: 414 LGTEIKPIP 422


>AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p
           protein.
          Length = 945

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+ KV+ + + +    +  +++HGD  Q ER+ +++ FR G S +LI T
Sbjct: 495 IVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIAT 548



 Score = 35.1 bits (77), Expect = 0.096
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ +  VINYD P++ ENY
Sbjct: 552 SRGLDVEDLQYVINYDYPNSSENY 575


>AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-PB
           protein.
          Length = 945

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+ KV+ + + +    +  +++HGD  Q ER+ +++ FR G S +LI T
Sbjct: 495 IVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIAT 548



 Score = 35.1 bits (77), Expect = 0.096
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ +  VINYD P++ ENY
Sbjct: 552 SRGLDVEDLQYVINYDYPNSSENY 575


>X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family
           putative RNA helicase protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p
           protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,
           isoform C protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,
           isoform B protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,
           isoform A protein.
          Length = 424

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p
           protein.
          Length = 798

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++  +  V+++HGD  Q+ERE  +R FR+G   +L+ T
Sbjct: 563 LIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVAT 616



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +R    D+ +   
Sbjct: 620 ARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLELLI 679

Query: 442 TSIVEMPS 465
            +  E+PS
Sbjct: 680 ETKQEIPS 687


>AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p
           protein.
          Length = 791

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 20/75 (26%), Positives = 40/75 (53%)
 Frame = +2

Query: 29  LEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           L++W    LC L   LS    +IF   +   + ++ ++ ++++    +HGDMDQ +R  +
Sbjct: 498 LQKWNW-LLCHLVKFLSEGSVLIFVTKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKV 556

Query: 209 MRQFRTGSSRVLITT 253
           + QF+     +L+ T
Sbjct: 557 ITQFKRKECDILVAT 571


>AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA
           protein.
          Length = 798

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++  +  V+++HGD  Q+ERE  +R FR+G   +L+ T
Sbjct: 563 LIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVAT 616



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +R    D+ +   
Sbjct: 620 ARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLELLI 679

Query: 442 TSIVEMPS 465
            +  E+PS
Sbjct: 680 ETKQEIPS 687


>AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB
           protein.
          Length = 791

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 20/75 (26%), Positives = 40/75 (53%)
 Frame = +2

Query: 29  LEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           L++W    LC L   LS    +IF   +   + ++ ++ ++++    +HGDMDQ +R  +
Sbjct: 498 LQKWNW-LLCHLVKFLSEGSVLIFVTKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKV 556

Query: 209 MRQFRTGSSRVLITT 253
           + QF+     +L+ T
Sbjct: 557 ITQFKRKECDILVAT 571


>AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p
           protein.
          Length = 703

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIA-QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           K  T+      +S   + +IFC  + + D L+  + L  F    +HG+ DQ +RE  +  
Sbjct: 515 KFNTITSFVKNMSSTDKIIIFCGRKVRADDLSSELTLDGFMTQCIHGNRDQMDREQAIAD 574

Query: 218 FRTGSSRVLITT 253
            ++G  R+L+ T
Sbjct: 575 IKSGVVRILVAT 586



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D++ ++ VINYD P N E Y                 +F T  D    K++ +   
Sbjct: 590 SRGLDIEDITHVINYDFPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQ 649

Query: 442 TSIVEMPSDVANL 480
            +  E+P ++ N+
Sbjct: 650 EAEQEVPDELHNM 662


>AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563
           protein.
          Length = 1028

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/78 (24%), Positives = 38/78 (48%)
 Frame = +2

Query: 20  AIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           ++E    KL+ L  +++ L   QA+IF +++ + D     +         + G M+Q ER
Sbjct: 252 SVEEMRLKLQILGQIFNQLPYEQAIIFASSQMRADSYKNYLTASGIDCHLISGAMEQSER 311

Query: 200 EVIMRQFRTGSSRVLITT 253
             +   +R  + R+L+ T
Sbjct: 312 LHVFEGYRNFTMRILVAT 329


>AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA
           protein.
          Length = 1028

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/78 (24%), Positives = 38/78 (48%)
 Frame = +2

Query: 20  AIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           ++E    KL+ L  +++ L   QA+IF +++ + D     +         + G M+Q ER
Sbjct: 252 SVEEMRLKLQILGQIFNQLPYEQAIIFASSQMRADSYKNYLTASGIDCHLISGAMEQSER 311

Query: 200 EVIMRQFRTGSSRVLITT 253
             +   +R  + R+L+ T
Sbjct: 312 LHVFEGYRNFTMRILVAT 329


>U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 725

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRD--FTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           D  ++ +A+IFC T++  D L   +  RD  ++   +HGD   +ER+  +  F+    + 
Sbjct: 500 DKHNMDRAIIFCRTKQDCDNLERFLRQRDKHYSCVCLHGDRKPQERKENLEMFKRQQVKF 559

Query: 242 LITT 253
           LI T
Sbjct: 560 LICT 563


>BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p
           protein.
          Length = 822

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGID++ VS VINYD+    E+Y                 +FVT+ D     D++     
Sbjct: 728 RGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSA 787

Query: 445 SIVE-MPSDVAN 477
           S V   P ++ N
Sbjct: 788 SPVSTCPPELMN 799



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N ++  D L + +    +    +HG   Q +RE  +   ++G+  +L+ T
Sbjct: 670 IIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVAT 723


>AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p
           protein.
          Length = 641

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGID++ VS VINYD+    E+Y                 +FVT+ D     D++     
Sbjct: 547 RGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSA 606

Query: 445 SIVE-MPSDVAN 477
           S V   P ++ N
Sbjct: 607 SPVSTCPPELMN 618



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N ++  D L + +    +    +HG   Q +RE  +   ++G+  +L+ T
Sbjct: 489 IIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVAT 542


>AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-PA
           protein.
          Length = 822

 Score = 36.7 bits (81), Expect = 0.031
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGID++ VS VINYD+    E+Y                 +FVT+ D     D++     
Sbjct: 728 RGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSA 787

Query: 445 SIVE-MPSDVAN 477
           S V   P ++ N
Sbjct: 788 SPVSTCPPELMN 799



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N ++  D L + +    +    +HG   Q +RE  +   ++G+  +L+ T
Sbjct: 670 IIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVAT 723


>AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA
           protein.
          Length = 594

 Score = 35.9 bits (79), Expect = 0.055
 Identities = 21/69 (30%), Positives = 29/69 (42%)
 Frame = +1

Query: 220 SYWLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTE 399
           S W+  C +   L+ RGID + V+ VINYD P    +Y                  F T+
Sbjct: 416 SIWVLICTE---LMGRGIDFKGVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQ 472

Query: 400 ADRRALKDI 426
            D   L+ I
Sbjct: 473 EDTSNLRGI 481


>Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  +IF NT++    L+ ++   +     +HG M Q+ER   + +F++   R LI T
Sbjct: 252 ANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIAT 308


>L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  +IF NT++    L+ ++   +     +HG M Q+ER   + +F++   R LI T
Sbjct: 252 ANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIAT 308


>BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p
           protein.
          Length = 1224

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 18/72 (25%), Positives = 35/72 (48%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +KL  L  +Y        ++F + +   D L   +    +   ++HG +DQ +R+  +  
Sbjct: 745 FKLLELLGIYQ--EAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIID 802

Query: 218 FRTGSSRVLITT 253
           F++G  R+LI T
Sbjct: 803 FKSGKVRLLIAT 814



 Score = 35.1 bits (77), Expect = 0.096
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV+ +  V+NYD+P++ E+Y                  F+T    R   DI
Sbjct: 818 ARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQSRYAGDI 872


>AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p
           protein.
          Length = 521

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  +IF NT++    L+ ++   +     +HG M Q+ER   + +F++   R LI T
Sbjct: 252 ANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIAT 308


>AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p
           protein.
          Length = 680

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 18/72 (25%), Positives = 35/72 (48%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +KL  L  +Y        ++F + +   D L   +    +   ++HG +DQ +R+  +  
Sbjct: 201 FKLLELLGIYQ--EAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIID 258

Query: 218 FRTGSSRVLITT 253
           F++G  R+LI T
Sbjct: 259 FKSGKVRLLIAT 270



 Score = 35.1 bits (77), Expect = 0.096
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV+ +  V+NYD+P++ E+Y                  F+T    R   DI
Sbjct: 274 ARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQSRYAGDI 328


>AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA
           protein.
          Length = 1224

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 18/72 (25%), Positives = 35/72 (48%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +KL  L  +Y        ++F + +   D L   +    +   ++HG +DQ +R+  +  
Sbjct: 745 FKLLELLGIYQ--EAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIID 802

Query: 218 FRTGSSRVLITT 253
           F++G  R+LI T
Sbjct: 803 FKSGKVRLLIAT 814



 Score = 35.1 bits (77), Expect = 0.096
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV+ +  V+NYD+P++ E+Y                  F+T    R   DI
Sbjct: 818 ARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQSRYAGDI 872


>AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA
           protein.
          Length = 521

 Score = 35.5 bits (78), Expect = 0.072
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  +IF NT++    L+ ++   +     +HG M Q+ER   + +F++   R LI T
Sbjct: 252 ANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIAT 308


>AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p
           protein.
          Length = 727

 Score = 33.1 bits (72), Expect = 0.39
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLR---DFTVSAMHGDMDQREREVIMRQFRTGSSR 238
           D  ++ +A+IFC T++  D L   +  R    ++   +HGD   +ER+  +  F+    +
Sbjct: 501 DKHNMDRAIIFCRTKQDCDNLERFLRQRGGKHYSCVCLHGDRKPQERKENLEMFKRQQVK 560

Query: 239 VLITT 253
            LI T
Sbjct: 561 FLICT 565


>AF057167-1|AAD09429.1|  270|Drosophila melanogaster DEAD-box
           protein protein.
          Length = 270

 Score = 33.1 bits (72), Expect = 0.39
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLR---DFTVSAMHGDMDQREREVIMRQFRTGSSR 238
           D  ++ +A+IFC T++  D L   +  R    ++   +HGD   +ER+  +  F+    +
Sbjct: 44  DKHNMDRAIIFCRTKQDCDNLERFLRQRGGKHYSCVCLHGDRKPQERKENLEMFKRQQVK 103

Query: 239 VLITT 253
            LI T
Sbjct: 104 FLICT 108


>AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA
           protein.
          Length = 727

 Score = 33.1 bits (72), Expect = 0.39
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLR---DFTVSAMHGDMDQREREVIMRQFRTGSSR 238
           D  ++ +A+IFC T++  D L   +  R    ++   +HGD   +ER+  +  F+    +
Sbjct: 501 DKHNMDRAIIFCRTKQDCDNLERFLRQRGGKHYSCVCLHGDRKPQERKENLEMFKRQQVK 560

Query: 239 VLITT 253
            LI T
Sbjct: 561 FLICT 565


>BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p
           protein.
          Length = 782

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D+  V  VIN+ +P   E+Y                 +   E +R+ +KDI
Sbjct: 464 ARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKERKIVKDI 518


>AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p
           protein.
          Length = 619

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   V  VINYD+P + ENY
Sbjct: 489 SKGLDFPNVQHVINYDMPDDIENY 512


>AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt
           protein protein.
          Length = 619

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   V  VINYD+P + ENY
Sbjct: 489 SKGLDFPNVQHVINYDMPDDIENY 512


>AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box
           protein abstrakt protein.
          Length = 614

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   V  VINYD+P + ENY
Sbjct: 484 SKGLDFPNVQHVINYDMPDDIENY 507


>AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM05306
           protein.
          Length = 641

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D+  V  VIN+ +P   E+Y                 +   E +R+ +KDI
Sbjct: 464 ARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKERKIVKDI 518


>AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA
           protein.
          Length = 619

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   V  VINYD+P + ENY
Sbjct: 489 SKGLDFPNVQHVINYDMPDDIENY 512


>AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA
           protein.
          Length = 782

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D+  V  VIN+ +P   E+Y                 +   E +R+ +KDI
Sbjct: 464 ARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKERKIVKDI 518


>BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p
           protein.
          Length = 813

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VI+Y +P   ENY
Sbjct: 606 ARGLDIPNVEHVIHYQVPRTSENY 629



 Score = 30.3 bits (65), Expect = 2.7
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++FCN+   V  L     L D     +H +M Q++R   + +FR   + +LI T
Sbjct: 547 RTIVFCNSIDCVKRLATLFGLLDCNPLPLHANMIQKQRLKNLERFRDSPTGLLIAT 602


>AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p
           protein.
          Length = 507

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 9/24 (37%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V  V+N+D+P++ ++Y
Sbjct: 361 SRGLDIPHVDVVVNFDIPTHSKDY 384


>AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA
           protein.
          Length = 507

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 9/24 (37%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V  V+N+D+P++ ++Y
Sbjct: 361 SRGLDIPHVDVVVNFDIPTHSKDY 384


>AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA
           protein.
          Length = 813

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VI+Y +P   ENY
Sbjct: 606 ARGLDIPNVEHVIHYQVPRTSENY 629



 Score = 30.3 bits (65), Expect = 2.7
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++FCN+   V  L     L D     +H +M Q++R   + +FR   + +LI T
Sbjct: 547 RTIVFCNSIDCVKRLATLFGLLDCNPLPLHANMIQKQRLKNLERFRDSPTGLLIAT 602


>U92536-1|AAD41441.1| 1487|Drosophila melanogaster RECQ helicase
            homolog protein.
          Length = 1487

 Score = 30.3 bits (65), Expect = 2.7
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +2

Query: 92   VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTV 256
            +I+C +R++ D  ++ M        + H  +   +RE   + + TG  RV+  TV
Sbjct: 962  IIYCLSRKECDETSKKMCKDGVRAVSYHAGLTDTDRESRQKDWLTGKMRVICATV 1016


>AE014297-1368|AAF54691.1| 1487|Drosophila melanogaster CG6920-PA
            protein.
          Length = 1487

 Score = 30.3 bits (65), Expect = 2.7
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +2

Query: 92   VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTV 256
            +I+C +R++ D  ++ M        + H  +   +RE   + + TG  RV+  TV
Sbjct: 962  IIYCLSRKECDETSKKMCKDGVRAVSYHAGLTDTDRESRQKDWLTGKMRVICATV 1016


>AE014298-1910|AAF48274.2|  142|Drosophila melanogaster CG12726-PA
           protein.
          Length = 142

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 3/69 (4%)
 Frame = -1

Query: 283 AVHQYHVPINSGDQDTRRAST---KLPHDHFTLTLIHVSMHSRYSKVTQMHRFSEPIHLA 113
           +VH Y+VP  +    T   +T        H   T +H    S +   + MH+ + P+H  
Sbjct: 44  SVHYYNVPTTTTTSTTTTTTTVHQDTTSMHQDTTSMHQDTTSMHQDTSSMHQDTTPLHQD 103

Query: 112 TGVAENYSL 86
           T +  + SL
Sbjct: 104 TSMHHHSSL 112


>AE014298-914|AAF46176.1|  438|Drosophila melanogaster CG14443-PA
           protein.
          Length = 438

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 17/70 (24%), Positives = 31/70 (44%)
 Frame = +2

Query: 44  LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
           ++ L  +YDT  I   V+    R+KV      +         +HG    +E + I+  F 
Sbjct: 268 MKELTAIYDTSDIPGKVVIYVKRQKVVEELVDLIRNCVPCEGIHGGRTAQENQGIIHDFG 327

Query: 224 TGSSRVLITT 253
           TG+  +++ T
Sbjct: 328 TGAYNIIVAT 337


>M74824-1|AAC14192.1|  644|Drosophila melanogaster D-E-A-D box
           protein protein.
          Length = 644

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 17/56 (30%), Positives = 22/56 (39%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           LARGIDV  V  V++Y+ P +   Y                   +TE D    K I
Sbjct: 508 LARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDMTLFKKI 563


>BT010045-1|AAQ22514.1|  687|Drosophila melanogaster LD27814p
           protein.
          Length = 687

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 17/56 (30%), Positives = 22/56 (39%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           LARGIDV  V  V++Y+ P +   Y                   +TE D    K I
Sbjct: 508 LARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDMTLFKKI 563


>AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH02833
           protein.
          Length = 974

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 170 MHGDMDQREREVIMRQFRTGSSRVLITT 253
           +HG M Q ER+ + R FR  +S VL+ T
Sbjct: 683 LHGSMTQTERQGVFRGFRDCASCVLLAT 710


>AF132173-1|AAD34761.1|  687|Drosophila melanogaster unknown
           protein.
          Length = 687

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 17/56 (30%), Positives = 22/56 (39%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           LARGIDV  V  V++Y+ P +   Y                   +TE D    K I
Sbjct: 508 LARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDMTLFKKI 563


>AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB,
           isoform B protein.
          Length = 975

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 170 MHGDMDQREREVIMRQFRTGSSRVLITT 253
           +HG M Q ER+ + R FR  +S VL+ T
Sbjct: 684 LHGSMTQTERQGVFRGFRDCASCVLLAT 711


>AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA,
           isoform A protein.
          Length = 974

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 170 MHGDMDQREREVIMRQFRTGSSRVLITT 253
           +HG M Q ER+ + R FR  +S VL+ T
Sbjct: 683 LHGSMTQTERQGVFRGFRDCASCVLLAT 710


>AE014296-2792|AAF49419.1|  687|Drosophila melanogaster CG9680-PA
           protein.
          Length = 687

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 17/56 (30%), Positives = 22/56 (39%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           LARGIDV  V  V++Y+ P +   Y                   +TE D    K I
Sbjct: 508 LARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDMTLFKKI 563


>AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p
           protein.
          Length = 680

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ QV  ++ YD P +   Y
Sbjct: 494 ARGLDIPQVDWIVQYDPPDDPREY 517


>AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p
           protein.
          Length = 680

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ QV  ++ YD P +   Y
Sbjct: 494 ARGLDIPQVDWIVQYDPPDDPREY 517


>AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB,
           isoform B protein.
          Length = 680

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ QV  ++ YD P +   Y
Sbjct: 494 ARGLDIPQVDWIVQYDPPDDPREY 517


>AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA,
           isoform A protein.
          Length = 680

 Score = 28.7 bits (61), Expect = 8.3
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ QV  ++ YD P +   Y
Sbjct: 494 ARGLDIPQVDWIVQYDPPDDPREY 517


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,407,029
Number of Sequences: 53049
Number of extensions: 619024
Number of successful extensions: 1396
Number of sequences better than 10.0: 89
Number of HSP's better than 10.0 without gapping: 1283
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1386
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3170136354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -