SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...   228   7e-60
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...   228   7e-60
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...   228   7e-60
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...   228   7e-60
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...   228   7e-60
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...   227   2e-59
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...   227   2e-59
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...   227   2e-59
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...   225   5e-59
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...   219   4e-57
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...   219   4e-57
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...   153   2e-37
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...   153   2e-37
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...   121   9e-28
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...   121   9e-28
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   121   1e-27
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   121   1e-27
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   117   1e-26
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    68   1e-11
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    68   1e-11
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    68   1e-11
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    57   3e-08
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    57   3e-08
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    57   3e-08
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    45   1e-04
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    45   1e-04
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    45   1e-04
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    45   1e-04
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    45   1e-04
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    43   4e-04
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    43   4e-04
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    42   7e-04
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    40   0.005
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    39   0.008
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    39   0.008
BT003756-1|AAO41435.1|  674|Drosophila melanogaster RE71343p pro...    36   0.076
AY089551-1|AAL90289.1|  975|Drosophila melanogaster LD28793p pro...    36   0.076
AE014297-4212|AAF56769.1|  975|Drosophila melanogaster CG4849-PA...    36   0.076
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    33   0.30 
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    33   0.30 
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    33   0.30 
AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p pro...    32   0.93 
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    31   1.6  
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    31   1.6  
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    31   1.6  
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    31   1.6  
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    31   1.6  
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    31   1.6  
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    31   2.2  
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    31   2.2  
AY058470-1|AAL13699.1| 1018|Drosophila melanogaster GH27433p pro...    30   2.8  
AE014297-1858|AAF55066.3| 1131|Drosophila melanogaster CG8279-PA...    30   2.8  
BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p pro...    29   5.0  
AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein ...    29   5.0  
AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB...    29   5.0  
AY095529-1|AAM12260.1|  935|Drosophila melanogaster RE23942p pro...    29   8.7  
AY069790-1|AAL39935.1| 1047|Drosophila melanogaster SD03282p pro...    29   8.7  
AL009188-3|CAA15674.2| 1060|Drosophila melanogaster EG:165H7.3 p...    29   8.7  
AE014298-2820|AAF48937.2|  935|Drosophila melanogaster CG7884-PA...    29   8.7  
AE014298-33|AAF45504.2| 1047|Drosophila melanogaster CG3923-PA p...    29   8.7  

>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score =  228 bits (557), Expect = 7e-60
 Identities = 112/133 (84%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score =  228 bits (557), Expect = 7e-60
 Identities = 112/133 (84%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score =  228 bits (557), Expect = 7e-60
 Identities = 112/133 (84%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score =  228 bits (557), Expect = 7e-60
 Identities = 112/133 (84%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score =  228 bits (557), Expect = 7e-60
 Identities = 112/133 (84%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score =  227 bits (554), Expect = 2e-59
 Identities = 111/133 (83%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 194 SGWHGDNMLEPSTNM 208


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score =  227 bits (554), Expect = 2e-59
 Identities = 111/133 (83%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 194 SGWHGDNMLEPSTNM 208


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score =  227 bits (554), Expect = 2e-59
 Identities = 111/133 (83%), Positives = 113/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 194 SGWHGDNMLEPSTNM 208


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score =  225 bits (550), Expect = 5e-59
 Identities = 111/133 (83%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI AAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIDAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDSTEPPYSE R+EEIKKEVSSYIKKIGYNPA+VAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS KM
Sbjct: 194 SGWHGDNMLEPSEKM 208


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score =  219 bits (534), Expect = 4e-57
 Identities = 108/133 (81%), Positives = 110/133 (82%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKN QT
Sbjct: 121 GEFEAGISKNDQT 133



 Score =  153 bits (370), Expect = 3e-37
 Identities = 70/75 (93%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKK+GYNPAAVAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 194 SGWHGDNMLEPSTNM 208


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score =  219 bits (534), Expect = 4e-57
 Identities = 108/133 (81%), Positives = 110/133 (82%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKN QT
Sbjct: 121 GEFEAGISKNDQT 133



 Score =  153 bits (370), Expect = 3e-37
 Identities = 70/75 (93%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKK+GYNPAAVAFVPI
Sbjct: 134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 194 SGWHGDNMLEPSTNM 208


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPI
Sbjct: 33  REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPI 92

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 93  SGWHGDNMLEPSTNM 107



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +1

Query: 415 MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQT
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 32


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score =  153 bits (371), Expect = 2e-37
 Identities = 71/75 (94%), Positives = 73/75 (97%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQLIVGVNKMDS+EPPYSE R+EEIKKEVSSYIKKIGYNPAAVAFVPI
Sbjct: 33  REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPI 92

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPST M
Sbjct: 93  SGWHGDNMLEPSTNM 107



 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +1

Query: 415 MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQT
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 32


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =  121 bits (292), Expect = 9e-28
 Identities = 58/130 (44%), Positives = 84/130 (64%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E+++  K            
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
               + GIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEF
Sbjct: 304 GEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEF 363

Query: 481 EAGISKNGQT 510
           E+G    GQT
Sbjct: 364 ESGFELGGQT 373



 Score = 58.8 bits (136), Expect = 7e-09
 Identities = 29/68 (42%), Positives = 45/68 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA+L  +LGV QL V +NK+D+    +S+ RF EI  ++ S++K  G+  + V+F P 
Sbjct: 374 REHAILVRSLGVNQLGVVINKLDTVG--WSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPC 431

Query: 690 SGWHGDNM 713
           SG  G+N+
Sbjct: 432 SGLTGENL 439


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =  121 bits (292), Expect = 9e-28
 Identities = 58/130 (44%), Positives = 84/130 (64%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E+++  K            
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
               + GIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEF
Sbjct: 304 GEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEF 363

Query: 481 EAGISKNGQT 510
           E+G    GQT
Sbjct: 364 ESGFELGGQT 373



 Score = 58.8 bits (136), Expect = 7e-09
 Identities = 29/68 (42%), Positives = 45/68 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA+L  +LGV QL V +NK+D+    +S+ RF EI  ++ S++K  G+  + V+F P 
Sbjct: 374 REHAILVRSLGVNQLGVVINKLDTVG--WSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPC 431

Query: 690 SGWHGDNM 713
           SG  G+N+
Sbjct: 432 SGLTGENL 439


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  121 bits (291), Expect = 1e-27
 Identities = 56/130 (43%), Positives = 85/130 (65%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  ++   +       
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G T+++    FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEF
Sbjct: 252 QEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEF 311

Query: 481 EAGISKNGQT 510
           E G  + GQT
Sbjct: 312 ETGFDRGGQT 321



 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 1/66 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK L+V VNKMD     + + R+ E K ++  Y+KK+G+NPA  + F+P
Sbjct: 322 REHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMP 381

Query: 687 ISGWHG 704
            SG  G
Sbjct: 382 CSGLSG 387


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  121 bits (291), Expect = 1e-27
 Identities = 56/130 (43%), Positives = 85/130 (65%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  ++   +       
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G T+++    FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEF
Sbjct: 252 QEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEF 311

Query: 481 EAGISKNGQT 510
           E G  + GQT
Sbjct: 312 ETGFDRGGQT 321



 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 1/66 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK L+V VNKMD     + + R+ E K ++  Y+KK+G+NPA  + F+P
Sbjct: 322 REHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMP 381

Query: 687 ISGWHG 704
            SG  G
Sbjct: 382 CSGLSG 387


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  117 bits (282), Expect = 1e-26
 Identities = 58/131 (44%), Positives = 86/131 (65%), Gaps = 1/131 (0%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNML-GYWTN 297
           ++ H+N+V IGHVD+GKST  G ++   G + KRT+EK+E+EA+E  ++   +  G  TN
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKYEREAREKSRESWYLSWGLDTN 251

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
            +     G T+ +    FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GE
Sbjct: 252 -QEERDKGKTVGVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGE 310

Query: 478 FEAGISKNGQT 510
           FE G  + GQT
Sbjct: 311 FETGFDRGGQT 321



 Score = 67.7 bits (158), Expect = 2e-11
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK L+V VNKMD     + + R+ E K ++  Y+KK+G+NPA  + F+P
Sbjct: 322 REHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMP 381

Query: 687 ISGWHGDNM 713
            SG  G  +
Sbjct: 382 CSGLSGTGL 390


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 45/119 (37%), Positives = 62/119 (52%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H N+  IGHVD GK+T T  +       DK+  E   K+  E    P         
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLTAAITKVLA--DKQLAES--KKYNEIDNAPEEK------ 127

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                + GITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G
Sbjct: 128 -----ARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG 181



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN 662
           REH LLA  +G+  ++V +NK+D+ +    E   + ++ E+   + ++GY+
Sbjct: 187 REHMLLAKQIGIDHIVVFINKVDAAD----EEMVDLVEMEIRELLTEMGYD 233


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 45/119 (37%), Positives = 62/119 (52%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H N+  IGHVD GK+T T  +       DK+  E   K+  E    P         
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLTAAITKVLA--DKQLAES--KKYNEIDNAPEEK------ 127

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                + GITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G
Sbjct: 128 -----ARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG 181



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN 662
           REH LLA  +G+  ++V +NK+D+ +    E   + ++ E+   + ++GY+
Sbjct: 187 REHMLLAKQIGIDHIVVFINKVDAAD----EEMVDLVEMEIRELLTEMGYD 233


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 45/119 (37%), Positives = 62/119 (52%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H N+  IGHVD GK+T T  +       DK+  E   K+  E    P         
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLTAAITKVLA--DKQLAES--KKYNEIDNAPEEK------ 127

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                + GITI++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G
Sbjct: 128 -----ARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG 181



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN 662
           REH LLA  +G+  ++V +NK+D+ +    E   + ++ E+   + ++GY+
Sbjct: 187 REHMLLAKQIGIDHIVVFINKVDAAD----EEMVDLVEMEIRELLTEMGYD 233


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHL--IYKCGGI-DKRTIEKFEKEAQEWVKDPSNMLGY 288
           +E  H N+  IGHVD GK+T T  +  I    G+ +  + ++ ++  +E  +        
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA 
Sbjct: 105 ----------GITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAAT 154

Query: 469 TGE 477
            G+
Sbjct: 155 DGQ 157



 Score = 30.7 bits (66), Expect = 2.2
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY 641
           REH LLA  +G++++IV +NK D  +    E    E+++ +S +
Sbjct: 162 REHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDF 205


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHL--IYKCGGI-DKRTIEKFEKEAQEWVKDPSNMLGY 288
           +E  H N+  IGHVD GK+T T  +  I    G+ +  + ++ ++  +E  +        
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA 
Sbjct: 105 ----------GITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAAT 154

Query: 469 TGE 477
            G+
Sbjct: 155 DGQ 157



 Score = 30.7 bits (66), Expect = 2.2
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY 641
           REH LLA  +G++++IV +NK D  +    E    E+++ +S +
Sbjct: 162 REHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDF 205


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHL--IYKCGGI-DKRTIEKFEKEAQEWVKDPSNMLGY 288
           +E  H N+  IGHVD GK+T T  +  I    G+ +  + ++ ++  +E  +        
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA 
Sbjct: 105 ----------GITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAAT 154

Query: 469 TGE 477
            G+
Sbjct: 155 DGQ 157



 Score = 30.7 bits (66), Expect = 2.2
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY 641
           REH LLA  +G++++IV +NK D  +    E    E+++ +S +
Sbjct: 162 REHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDF 205


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K++   N+ VI HVD GKST T  L+ K G I      + R  +  + E +  +   S
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +        V IT      K E   + + +ID+PGH DF   +       D A++
Sbjct: 73  TAISMYFEVEEKDLVFITHPDQREK-ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALV 131

Query: 454 IVAAGTG 474
           +V   +G
Sbjct: 132 VVDCVSG 138


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K++   N+ VI HVD GKST T  L+ K G I      + R  +  + E +  +   S
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +        V IT      K E   + + +ID+PGH DF   +       D A++
Sbjct: 73  TAISMYFEVEEKDLVFITHPDQREK-ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALV 131

Query: 454 IVAAGTG 474
           +V   +G
Sbjct: 132 VVDCVSG 138


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K++   N+ VI HVD GKST T  L+ K G I      + R  +  + E +  +   S
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKS 60

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +        V IT      K E   + + +ID+PGH DF   +       D A++
Sbjct: 61  TAISMYFEVEEKDLVFITHPDQREK-ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALV 119

Query: 454 IVAAGTG 474
           +V   +G
Sbjct: 120 VVDCVSG 126


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K++   N+ VI HVD GKST T  L+ K G I      + R  +  + E +  +   S
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKS 60

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +        V IT      K E   + + +ID+PGH DF   +       D A++
Sbjct: 61  TAISMYFEVEEKDLVFITHPDQREK-ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALV 119

Query: 454 IVAAGTG 474
           +V   +G
Sbjct: 120 VVDCVSG 126


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K++   N+ VI HVD GKST T  L+ K G I      + R  +  + E +  +   S
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +        V IT      K E   + + +ID+PGH DF   +       D A++
Sbjct: 73  TAISMYFEVEEKDLVFITHPDQREK-ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALV 131

Query: 454 IVAAGTG 474
           +V   +G
Sbjct: 132 VVDCVSG 138


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 4/128 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  +++  G    R  E  E      V+   N+     +  L   
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTG----RIAEMHE------VRGKDNVGATMDSMELERQ 93

Query: 316 VGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
            GITI  A    LWK +T+   + IID PGH DF   +       D AVL++ A  G   
Sbjct: 94  RGITIQSAATYTLWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQS 149

Query: 484 AGISKNGQ 507
             ++ N Q
Sbjct: 150 ETLTVNRQ 157


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 4/128 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  +++  G    R  E  E      V+   N+     +  L   
Sbjct: 44  NIGISAHIDSGKTTLTERILFYTG----RIAEMHE------VRGKDNVGATMDSMELERQ 93

Query: 316 VGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
            GITI  A    LWK +T+   + IID PGH DF   +       D AVL++ A  G   
Sbjct: 94  RGITIQSAATYTLWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQS 149

Query: 484 AGISKNGQ 507
             ++ N Q
Sbjct: 150 QTLTVNRQ 157


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 33/117 (28%), Positives = 53/117 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  +++  G          +  A   V   + +  Y T  R    
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG----------KTRALGEVHRGNTVTDYLTQER---E 81

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 486
            GITI  +   F  + + + ++D PGH DF   +       D  V++V  GT   EA
Sbjct: 82  RGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVEQSLYAVD-GVVVVLDGTAGVEA 137


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 29/108 (26%), Positives = 48/108 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ HVD GK+T    L+   G I +R   K       ++ + S+        + S S
Sbjct: 21  NICILAHVDHGKTTLADSLVASNGIISQRMAGKLR-----YLDNRSDEQERGITMKSS-S 74

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           + +    A        Y + +ID+PGH DF   + T     D A+++V
Sbjct: 75  ISLYYQEAEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 122


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 32/116 (27%), Positives = 50/116 (43%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           + NI ++GHVDSGK+T    L      I       F+K  Q   +  +  LG+       
Sbjct: 4   NFNIGLLGHVDSGKTTLAKAL----SSISSTAA--FDKNPQSVERGITLDLGF------- 50

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
              G+ +D      +  +   T +D PGH   I+ +I G    D  +L+V A  G+
Sbjct: 51  --SGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGK 104


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 32/116 (27%), Positives = 50/116 (43%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           + NI ++GHVDSGK+T    L      I       F+K  Q   +  +  LG+       
Sbjct: 4   NFNIGLLGHVDSGKTTLAKAL----SSISSTAA--FDKNPQSVERGITLDLGF------- 50

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
              G+ +D      +  +   T +D PGH   I+ +I G    D  +L+V A  G+
Sbjct: 51  --SGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGK 104


>BT003756-1|AAO41435.1|  674|Drosophila melanogaster RE71343p
           protein.
          Length = 674

 Score = 35.5 bits (78), Expect = 0.076
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+T    LI       ++T  +FE   +  ++    +   +T      S
Sbjct: 133 NVALVGHLHHGKTTFVDCLI-------RQTHPQFETMEERQLRYTDTL---FTEQERGCS 182

Query: 316 VGIT-IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +  T + + L   +   Y + I D PGH +F          +D  VL + A  G
Sbjct: 183 IKATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEG 236


>AY089551-1|AAL90289.1|  975|Drosophila melanogaster LD28793p
           protein.
          Length = 975

 Score = 35.5 bits (78), Expect = 0.076
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+T    LI       ++T  +FE   +  ++    +   +T      S
Sbjct: 133 NVALVGHLHHGKTTFVDCLI-------RQTHPQFETMEERQLRYTDTL---FTEQERGCS 182

Query: 316 VGIT-IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +  T + + L   +   Y + I D PGH +F          +D  VL + A  G
Sbjct: 183 IKATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEG 236


>AE014297-4212|AAF56769.1|  975|Drosophila melanogaster CG4849-PA
           protein.
          Length = 975

 Score = 35.5 bits (78), Expect = 0.076
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+T    LI       ++T  +FE   +  ++    +   +T      S
Sbjct: 133 NVALVGHLHHGKTTFVDCLI-------RQTHPQFETMEERQLRYTDTL---FTEQERGCS 182

Query: 316 VGIT-IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +  T + + L   +   Y + I D PGH +F          +D  VL + A  G
Sbjct: 183 IKATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEG 236


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 30/113 (26%), Positives = 43/113 (38%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I HVD GKST    L+   G I +          Q  V D   +          ++
Sbjct: 81  NFSIIAHVDHGKSTLADRLLELTGAIARNG-------GQHQVLDNLQV-----ERERGIT 128

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V         + +   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 129 VKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 181


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 30/113 (26%), Positives = 43/113 (38%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I HVD GKST    L+   G I +          Q  V D   +          ++
Sbjct: 101 NFSIIAHVDHGKSTLADRLLELTGAIARNG-------GQHQVLDNLQV-----ERERGIT 148

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V         + +   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 149 VKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 30/113 (26%), Positives = 43/113 (38%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I HVD GKST    L+   G I +          Q  V D   +          ++
Sbjct: 101 NFSIIAHVDHGKSTLADRLLELTGAIARNG-------GQHQVLDNLQV-----ERERGIT 148

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V         + +   Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 149 VKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p
           protein.
          Length = 949

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 364 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 7   YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 38


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 159


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 151


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 159


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 159


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 151


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 159


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           VT +D PGH  F      G    D  VL+VAA  G
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           VT +D PGH  F      G    D  VL+VAA  G
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>AY058470-1|AAL13699.1| 1018|Drosophila melanogaster GH27433p
           protein.
          Length = 1018

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 17/69 (24%), Positives = 33/69 (47%)
 Frame = +3

Query: 501 RSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 680
           R++ E  ++ F +G+  ++    +M + +  Y + RF     E+     K GY   A+  
Sbjct: 201 RASAEEIIIPFGIGIAGMVAQTKQMINIKEAYKDARFN---CEIDL---KTGYKTNAILC 254

Query: 681 VPISGWHGD 707
           +PI  + GD
Sbjct: 255 MPICNYEGD 263


>AE014297-1858|AAF55066.3| 1131|Drosophila melanogaster CG8279-PA
           protein.
          Length = 1131

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 17/69 (24%), Positives = 33/69 (47%)
 Frame = +3

Query: 501 RSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 680
           R++ E  ++ F +G+  ++    +M + +  Y + RF     E+     K GY   A+  
Sbjct: 314 RASAEEIIIPFGIGIAGMVAQTKQMINIKEAYKDARFN---CEIDL---KTGYKTNAILC 367

Query: 681 VPISGWHGD 707
           +PI  + GD
Sbjct: 368 MPICNYEGD 376


>BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 5.0
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 5.0
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 5.0
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AY095529-1|AAM12260.1|  935|Drosophila melanogaster RE23942p
           protein.
          Length = 935

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 265 PLPIPGPPSRTSRWYVCQYHHI 200
           PLP P PP+ TS + + Q H +
Sbjct: 295 PLPTPAPPASTSSFEIVQSHQV 316


>AY069790-1|AAL39935.1| 1047|Drosophila melanogaster SD03282p
           protein.
          Length = 1047

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 313 SRSAFSLSNTQAYLKDPLPIPGP 245
           S +A S+ N   YL+ PLP PGP
Sbjct: 272 SLAALSVLNELLYLQKPLPFPGP 294


>AL009188-3|CAA15674.2| 1060|Drosophila melanogaster EG:165H7.3
           protein.
          Length = 1060

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 313 SRSAFSLSNTQAYLKDPLPIPGP 245
           S +A S+ N   YL+ PLP PGP
Sbjct: 285 SLAALSVLNELLYLQKPLPFPGP 307


>AE014298-2820|AAF48937.2|  935|Drosophila melanogaster CG7884-PA
           protein.
          Length = 935

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 265 PLPIPGPPSRTSRWYVCQYHHI 200
           PLP P PP+ TS + + Q H +
Sbjct: 295 PLPTPAPPASTSSFEIVQSHQV 316


>AE014298-33|AAF45504.2| 1047|Drosophila melanogaster CG3923-PA
           protein.
          Length = 1047

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 313 SRSAFSLSNTQAYLKDPLPIPGP 245
           S +A S+ N   YL+ PLP PGP
Sbjct: 272 SLAALSVLNELLYLQKPLPFPGP 294


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,638,844
Number of Sequences: 53049
Number of extensions: 692065
Number of successful extensions: 2330
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 2154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2290
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3314233461
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -