SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF145608-1|AAD38583.1|  674|Drosophila melanogaster BcDNA.GH0275...    29   6.0  
AE014298-2816|AAF48933.1| 1513|Drosophila melanogaster CG12359-P...    29   6.0  
BT024336-1|ABC86398.1|  271|Drosophila melanogaster IP10110p pro...    29   8.0  
AY071529-1|AAL49151.1|  508|Drosophila melanogaster RE57384p pro...    29   8.0  
AF441757-1|AAM20921.1|  508|Drosophila melanogaster metallo endo...    29   8.0  
AE014134-1566|AAO41172.1|  257|Drosophila melanogaster CG32987-P...    29   8.0  
AE013599-1348|AAF58617.2|  508|Drosophila melanogaster CG8988-PA...    29   8.0  

>AF145608-1|AAD38583.1|  674|Drosophila melanogaster BcDNA.GH02751
           protein.
          Length = 674

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 15/54 (27%), Positives = 28/54 (51%)
 Frame = -3

Query: 664 IFDPMIPMQFQIRDPAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQDKLRWSVHN 503
           IF+P +  Q ++R+ AP+VP    + + SQ    +  ++  +   D +R   HN
Sbjct: 107 IFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLG-HN 159


>AE014298-2816|AAF48933.1| 1513|Drosophila melanogaster CG12359-PA
            protein.
          Length = 1513

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 15/54 (27%), Positives = 28/54 (51%)
 Frame = -3

Query: 664  IFDPMIPMQFQIRDPAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQDKLRWSVHN 503
            IF+P +  Q ++R+ AP+VP    + + SQ    +  ++  +   D +R   HN
Sbjct: 946  IFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLG-HN 998


>BT024336-1|ABC86398.1|  271|Drosophila melanogaster IP10110p
           protein.
          Length = 271

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = -1

Query: 513 VCTTRINMHYINDV-PHITASGCLGLALIGSCLNSS 409
           VCTT    H+I+D+ P I +   +G+ALI   LN S
Sbjct: 110 VCTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFS 145


>AY071529-1|AAL49151.1|  508|Drosophila melanogaster RE57384p
           protein.
          Length = 508

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -2

Query: 443 AWLSLVVVSIVVPTGLLLLGLAPCCWFD 360
           AWL L+  ++V   GL L+   PC  FD
Sbjct: 426 AWLLLLKYNVVFSIGLALINAIPCFGFD 453


>AF441757-1|AAM20921.1|  508|Drosophila melanogaster metallo
           endopeptidase protein.
          Length = 508

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -2

Query: 443 AWLSLVVVSIVVPTGLLLLGLAPCCWFD 360
           AWL L+  ++V   GL L+   PC  FD
Sbjct: 426 AWLLLLKYNVVFSIGLALINAIPCFGFD 453


>AE014134-1566|AAO41172.1|  257|Drosophila melanogaster CG32987-PA
           protein.
          Length = 257

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = -1

Query: 513 VCTTRINMHYINDV-PHITASGCLGLALIGSCLNSS 409
           VCTT    H+I+D+ P I +   +G+ALI   LN S
Sbjct: 96  VCTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFS 131


>AE013599-1348|AAF58617.2|  508|Drosophila melanogaster CG8988-PA
           protein.
          Length = 508

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -2

Query: 443 AWLSLVVVSIVVPTGLLLLGLAPCCWFD 360
           AWL L+  ++V   GL L+   PC  FD
Sbjct: 426 AWLLLLKYNVVFSIGLALINAIPCFGFD 453


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,495,645
Number of Sequences: 53049
Number of extensions: 629883
Number of successful extensions: 2061
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2061
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3046624548
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -