SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070905-1|AAL48527.1| 1051|Drosophila melanogaster RE02096p pro...    35   0.087
AE014296-3007|AAF49271.2| 1051|Drosophila melanogaster CG13699-P...    35   0.087
AY167906-1|AAO32794.1| 1200|Drosophila melanogaster scribbled pr...    33   0.35 
AY167905-1|AAO32793.1| 1069|Drosophila melanogaster scribbled pr...    33   0.35 
AY167904-1|AAO32792.1| 1850|Drosophila melanogaster scribbled pr...    33   0.35 
AY167903-1|AAO32791.1| 1205|Drosophila melanogaster scribbled pr...    33   0.35 
AJ252084-1|CAB70601.1| 1756|Drosophila melanogaster Vartul-1 pro...    33   0.35 
AE014297-1933|AAF55130.1|  537|Drosophila melanogaster CG3984-PA...    30   2.5  
BT015240-1|AAT94469.1| 1756|Drosophila melanogaster RE02389p pro...    29   3.3  
AY069661-1|AAL39806.2| 1581|Drosophila melanogaster LD43989p pro...    29   3.3  
AF190774-1|AAF26357.2| 1756|Drosophila melanogaster Scribble pro...    29   3.3  
AE014297-3963|AAX52996.1| 1711|Drosophila melanogaster CG5462-PI...    29   3.3  
AE014297-3962|ABI31210.1| 1756|Drosophila melanogaster CG5462-PG...    29   3.3  
AE014297-3961|AAN14077.1| 1756|Drosophila melanogaster CG5462-PB...    29   3.3  
AE014297-3960|AAN14076.1| 1756|Drosophila melanogaster CG5462-PA...    29   3.3  
AE014297-3959|AAF56598.2| 1851|Drosophila melanogaster CG5462-PD...    29   3.3  
AE014297-3958|AAX52995.2| 1939|Drosophila melanogaster CG5462-PH...    29   3.3  
BT024283-1|ABC86345.1|  818|Drosophila melanogaster IP13967p pro...    29   4.3  
AE014298-2221|AAF48513.2|  793|Drosophila melanogaster CG8959-PA...    29   4.3  
AE014296-3596|AAN12186.2| 1326|Drosophila melanogaster CG33291-P...    29   4.3  
BT023408-1|AAY55824.1| 1585|Drosophila melanogaster AT18603p pro...    29   5.7  
AY071278-1|AAL48900.1|  347|Drosophila melanogaster RE30702p pro...    29   5.7  
AE014134-1126|AAF52412.2| 1585|Drosophila melanogaster CG31635-P...    29   5.7  
AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p pro...    28   7.5  
AE014298-2404|AAF48609.1|  511|Drosophila melanogaster CG9968-PB...    28   7.5  
AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-P...    28   7.5  
AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA...    28   7.5  
AE014296-1943|AAF50070.1|  428|Drosophila melanogaster CG6163-PA...    28   9.9  

>AY070905-1|AAL48527.1| 1051|Drosophila melanogaster RE02096p
           protein.
          Length = 1051

 Score = 34.7 bits (76), Expect = 0.087
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           +PGY   + PA        P P+ P    T      Y S+ Y  P+ + + T  +VP  P
Sbjct: 206 RPGYVFDESPAPSYRRPTRPPPSLPPPPTTAAHKISYDSHDYPPPSYAAEQTSNFVPQQP 265

Query: 483 Q 485
           +
Sbjct: 266 K 266


>AE014296-3007|AAF49271.2| 1051|Drosophila melanogaster CG13699-PA
           protein.
          Length = 1051

 Score = 34.7 bits (76), Expect = 0.087
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           +PGY   + PA        P P+ P    T      Y S+ Y  P+ + + T  +VP  P
Sbjct: 206 RPGYVFDESPAPSYRRPTRPPPSLPPPPTTAAHKISYDSHDYPPPSYAAEQTSNFVPQQP 265

Query: 483 Q 485
           +
Sbjct: 266 K 266


>AY167906-1|AAO32794.1| 1200|Drosophila melanogaster scribbled
            protein.
          Length = 1200

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P   P  S D T    P T
Sbjct: 852  QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAPVASADLTAPDTPAT 903

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 904  QTVALIHAEQQAHQQQQQTQLAPLGQE 930


>AY167905-1|AAO32793.1| 1069|Drosophila melanogaster scribbled
            protein.
          Length = 1069

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P   P  S D T    P T
Sbjct: 861  QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAPVASADLTAPDTPAT 912

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 913  QTVALIHAEQQAHQQQQQTQLAPLGQE 939


>AY167904-1|AAO32792.1| 1850|Drosophila melanogaster scribbled
            protein.
          Length = 1850

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P   P  S D T    P T
Sbjct: 1502 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAPVASADLTAPDTPAT 1553

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1554 QTVALIHAEQQAHQQQQQTQLAPLGQE 1580


>AY167903-1|AAO32791.1| 1205|Drosophila melanogaster scribbled
            protein.
          Length = 1205

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P   P  S D T    P T
Sbjct: 857  QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAPVASADLTAPDTPAT 908

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 909  QTVALIHAEQQAHQQQQQTQLAPLGQE 935


>AJ252084-1|CAB70601.1| 1756|Drosophila melanogaster Vartul-1 protein
            protein.
          Length = 1756

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P   P  S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAPVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AE014297-1933|AAF55130.1|  537|Drosophila melanogaster CG3984-PA
           protein.
          Length = 537

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 3/54 (5%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTA-PRGHVTPH--GAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P    YP + P  T  P  +V P   G      YP V P  +++  +  VP+TP
Sbjct: 111 PNTPQYPTVVPNNTFNPNVNVVPATPGCPNTPQYPTVVPNNTFNPNVNVVPSTP 164



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 3/54 (5%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTA-PRGHVTPH--GAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P    YP + P  T  P  +V P   G      YP V P  +++  +  VP TP
Sbjct: 139 PNTPQYPTVVPNNTFNPNVNVVPSTPGCPNTPQYPTVVPNNTFNPNVNVVPATP 192


>BT015240-1|AAT94469.1| 1756|Drosophila melanogaster RE02389p protein.
          Length = 1756

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AY069661-1|AAL39806.2| 1581|Drosophila melanogaster LD43989p protein.
          Length = 1581

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1233 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1284

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1285 QTVALIHAEQQAHQQQQQTQLAPLGQE 1311


>AF190774-1|AAF26357.2| 1756|Drosophila melanogaster Scribble protein.
          Length = 1756

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AE014297-3963|AAX52996.1| 1711|Drosophila melanogaster CG5462-PI,
            isoform I protein.
          Length = 1711

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1503 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1554

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1555 QTVALIHAEQQAHQQQQQTQLAPLGQE 1581


>AE014297-3962|ABI31210.1| 1756|Drosophila melanogaster CG5462-PG,
            isoform G protein.
          Length = 1756

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AE014297-3961|AAN14077.1| 1756|Drosophila melanogaster CG5462-PB,
            isoform B protein.
          Length = 1756

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AE014297-3960|AAN14076.1| 1756|Drosophila melanogaster CG5462-PA,
            isoform A protein.
          Length = 1756

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1408 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1459

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1460 QTVALIHAEQQAHQQQQQTQLAPLGQE 1486


>AE014297-3959|AAF56598.2| 1851|Drosophila melanogaster CG5462-PD,
            isoform D protein.
          Length = 1851

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1503 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1554

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1555 QTVALIHAEQQAHQQQQQTQLAPLGQE 1581


>AE014297-3958|AAX52995.2| 1939|Drosophila melanogaster CG5462-PH,
            isoform H protein.
          Length = 1939

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 303  QP-GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTT 479
            QP G S+    AAM +   +P P A   ++TP         P      S D T    P T
Sbjct: 1591 QPTGPSVLAAAAAMVHGASSPTPPAATSNITP--------LPTAAAVASADLTAPDTPAT 1642

Query: 480  PQNASILSEKQWWLVMKVTMVVPLGDQ 560
               A I +E+Q     + T + PLG +
Sbjct: 1643 QTVALIHAEQQAHQQQQQTQLAPLGQE 1669


>BT024283-1|ABC86345.1|  818|Drosophila melanogaster IP13967p
           protein.
          Length = 818

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = -1

Query: 542 YHRDLHNQPPLLLAKYRSILRSCRNPFNCCII 447
           +H +  NQP L   K RS LR CR PF+  +I
Sbjct: 676 HHINPTNQPFLPEVKVRSALRGCRLPFSLELI 707


>AE014298-2221|AAF48513.2|  793|Drosophila melanogaster CG8959-PA
           protein.
          Length = 793

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = -1

Query: 542 YHRDLHNQPPLLLAKYRSILRSCRNPFNCCII 447
           +H +  NQP L   K RS LR CR PF+  +I
Sbjct: 651 HHINPTNQPFLPEVKVRSALRGCRLPFSLELI 682


>AE014296-3596|AAN12186.2| 1326|Drosophila melanogaster CG33291-PA
           protein.
          Length = 1326

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -2

Query: 133 LLLKFQNTRNTYLITAQNSEFRDPTFRLGRYRS 35
           L L+ Q + +TY   +  SE  +P  RLGRY S
Sbjct: 295 LTLRSQTSSSTYSSLSAGSESSEPARRLGRYSS 327


>BT023408-1|AAY55824.1| 1585|Drosophila melanogaster AT18603p
           protein.
          Length = 1585

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 342 SYPGITPAPTAPRGHVTPHGA 404
           SYP ++PAPT P    +P GA
Sbjct: 895 SYPSLSPAPTPPPPSTSPGGA 915


>AY071278-1|AAL48900.1|  347|Drosophila melanogaster RE30702p
           protein.
          Length = 347

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = +2

Query: 257 TTKLSCAWL*CSTFIPTRV*SRTTTCSNVLPRNHASTNCTS-RPCDTTWCIWLSKLSLCD 433
           TT  +CA    +T  PT     TTTC+       A T  T+  P  TT C   +  +LC 
Sbjct: 152 TTTTTCAPTTTTTCAPTT----TTTCAPTTTTTCAPTTTTTCAPTTTTTCTPTTTTTLCT 207

Query: 434 TN 439
            N
Sbjct: 208 NN 209


>AE014134-1126|AAF52412.2| 1585|Drosophila melanogaster CG31635-PA
           protein.
          Length = 1585

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 342 SYPGITPAPTAPRGHVTPHGA 404
           SYP ++PAPT P    +P GA
Sbjct: 895 SYPSLSPAPTPPPPSTSPGGA 915


>AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p
           protein.
          Length = 1193

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 17/41 (41%), Positives = 17/41 (41%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYP 425
           QPGY  GQQP     PG  P P  P       G  GY   P
Sbjct: 349 QPGYP-GQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388


>AE014298-2404|AAF48609.1|  511|Drosophila melanogaster CG9968-PB,
           isoform B protein.
          Length = 511

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 18/48 (37%), Positives = 19/48 (39%)
 Frame = +3

Query: 294 HSFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTP 437
           HS QP   +  Q     YPG  PAP  P     P  A  Y  YP   P
Sbjct: 49  HS-QPSSQMHPQQH-QQYPGGAPAPYPPMSAPYPSAAPSYPPYPTSNP 94


>AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-PA
           protein.
          Length = 881

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)
 Frame = +2

Query: 254 STTKLSCAWL*CSTFIPTRV*SRTTTCS---NVLPRNHASTNCTSRPCDTTWC 403
           +TT  +CA    +T  PT   + TTTC+   +       +T CTS+   TT C
Sbjct: 711 TTTTTTCAPTTTTTCTPTT--TTTTTCAPTTSSTTTTSTTTTCTSKTISTTTC 761


>AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA
           protein.
          Length = 1193

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 17/41 (41%), Positives = 17/41 (41%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYP 425
           QPGY  GQQP     PG  P P  P       G  GY   P
Sbjct: 349 QPGYP-GQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388


>AE014296-1943|AAF50070.1|  428|Drosophila melanogaster CG6163-PA
           protein.
          Length = 428

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +3

Query: 315 SLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPT 440
           ++G++PAA   P   P PTA  G   P G+F +      TPT
Sbjct: 129 TVGEEPAAPVAP--PPLPTATHGRGRPSGSFSWLQ-TATTPT 167


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,726,779
Number of Sequences: 53049
Number of extensions: 581906
Number of successful extensions: 2084
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 1923
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2066
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2172596895
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -